261

Re: Формы, механизмы, энергия наномира - 37

Victoria пишет:

В о-динитробензоле зелёные уши-чебурашки должны быть ориентированы в плоскости перпендикулярной плоскости бензольного цикла (в отличие от м-динитробензола). Это возможно при взаимодействии сиреневых электронов-колец атома азота сразу с двумя красными-электронами-кольцами соответствующего атома углерода.
Я хочу сказать, что в о-динитробензоле связь С-N будет иметь характер двойной связи: С=N, в отличие от одинарной в м-динитробензоле. Это можно установить экспериментально по меньшей длине и большей энергии данной связи (между углеродом и азотом) в о-динитробензоле, по сравнению с м-динитробензолом.

http://img-fotki.yandex.ru/get/6305/126580004.56/0_bd389_21b12eb4_S.gif
Оригинал: http://img-fotki.yandex.ru/get/6305/126 … 4_orig.gif

Кушелев: Возможно, что в результате "непростого нитрования" группы кислорода выходят из плоскости бензольного кольца...

Скрипт для 3DS Max:


nm = torus radius1:7.6 radius2:1 segs:100 sides:12 position:[0,0,0] wirecolor:[0,0,255]
nm1 = copy nm wirecolor:[255,0,255]
nm2 = copy nm wirecolor:[255,0,255]
move nm1 [0 , 0, 8]
move nm2 [0 , 0, -8]
rotate nm 90 [1,0,0]
move nm [0 , 8, 0]
nm11 = torus radius1:5.5 radius2:0.75 segs:100 sides:12 position:[0,0,5.5] wirecolor:[255,0,255]
nm21 = torus radius1:5.5 radius2:0.75 segs:100 sides:12 position:[0,0,-5.5] wirecolor:[255,0,255]
nm12 = torus radius1:4 radius2:0.5 segs:100 sides:12 position:[0,0,3.5] wirecolor:[255,0,255]
nm22 = torus radius1:4 radius2:0.5 segs:100 sides:12 position:[0,0,-3.5] wirecolor:[255,0,255]
ns = sphere radius:1 segs:20 position:[0,0,0] wirecolor:[255,255,0]
delete nm
g11 = group #(nm1,nm2,nm11,nm21,nm12,nm22,ns)
move g11 [0,32,0]
g11.pivot = [0,0,0]
ungroup g11
m1 = torus radius1:7.6 radius2:1 segs:100 sides:12 position:[0,0,0] wirecolor:[0,255,0]
rotate m1 90 [1,0,0]
move m1 [0,12,0]
m1.pivot = [0,0,0]
rotate m1 35.28 [1,0,0]
m2 = copy m1 wirecolor:[0,255,0]
m2.pivot = [0,0,0]
rotate m2 90 [0,0,1]
m3 = copy m2 wirecolor:[0,255,0]
m3.pivot = [0,0,0]
rotate m3 90 [0,0,1]
m4 = copy m3 wirecolor:[0,255,0]
m4.pivot = [0,0,0]
rotate m4 90 [0,0,1]
m5 = copy m4 wirecolor:[0,255,0]
m5.pivot = [0,0,0]
rotate m5 180 [0,1,0]
m6 = copy m5 wirecolor:[0,255,0]
m6.pivot = [0,0,0]
rotate m6 90 [0,0,1]
m7 = copy m6 wirecolor:[0,255,0]
m7.pivot = [0,0,0]
rotate m7 90 [0,0,1]
m8 = copy m7 wirecolor:[0,255,0]
m8.pivot = [0,0,0]
rotate m8 90 [0,0,1]
m11 = torus radius1:5.5 radius2:0.75 segs:100 sides:12 position:[0,0,5.5] wirecolor:[255,0,0]
m21 = torus radius1:5.5 radius2:0.75 segs:100 sides:12 position:[0,0,-5.5] wirecolor:[255,0,0]
g2 = group #(m11,m21)
rotate g2 90 [0,1,0]
rotate g2 35.28 [0,0,1]
rotate g2 -90 [1,0,0]
ungroup g2
s = sphere radius:1 segs:20 position:[0,0,0] wirecolor:[255,255,0]
delete m2
g1 = group #(m1,m3,m4,m5,m6,m7,m8,m11,m21,s)
g1.pivot = [0,0,0]
rotate g1 90 [1,0,0]
move g1 [15,46,0]
ungroup g1
mm1 = copy m1 wirecolor:[0,255,0]
mm3 = copy m3 wirecolor:[0,255,0]
mm4 = copy m4 wirecolor:[0,255,0]
mm5 = copy m5 wirecolor:[0,255,0]
mm6 = copy m6 wirecolor:[0,255,0]
mm7 = copy m7 wirecolor:[0,255,0]
mm8 = copy m8 wirecolor:[0,255,0]
mm11 = copy m11 wirecolor:[255,0,0]
mm21 = copy m21 wirecolor:[255,0,0]
ss = copy s wirecolor:[255,255,0]
g3 = group #(mm1,mm3,mm4,mm5,mm6,mm7,mm8,mm11,mm21,ss)
g3.pivot = [0,0,0]
rotate g3 180 [0,1,0]
g1 = group #(m1,m3,m4,m5,m6,m7,m8,m11,m21,s)
gno2 = group #(g1,g3)
gno2.pivot = [0,0,0]
rotate gno2 90 [0,1,0]
ungroup gno2
ungroup g1
ungroup g3
--copy
anm1 = copy nm1 wirecolor:[255,0,255]
anm2 = copy nm2 wirecolor:[255,0,255]
anm11 = copy nm11 wirecolor:[255,0,255]
anm21 = copy nm21 wirecolor:[255,0,255]
anm12 = copy nm12 wirecolor:[255,0,255]
anm22 = copy nm22 wirecolor:[255,0,255]
ans = copy ns wirecolor:[255,255,0]
am1 = copy m1 wirecolor:[0,255,0]
am3 = copy m3 wirecolor:[0,255,0]
am4 = copy m4 wirecolor:[0,255,0]
am5 = copy m5 wirecolor:[0,255,0]
am6 = copy m6 wirecolor:[0,255,0]
am7 = copy m7 wirecolor:[0,255,0]
am8 = copy m8 wirecolor:[0,255,0]
am11 = copy m11 wirecolor:[255,0,0]
am21 = copy m21 wirecolor:[255,0,0]
aas = copy s wirecolor:[255,255,0]
amm1 = copy mm1 wirecolor:[0,255,0]
amm3 = copy mm3 wirecolor:[0,255,0]
amm4 = copy mm4 wirecolor:[0,255,0]
amm5 = copy mm5 wirecolor:[0,255,0]
amm6 = copy mm6 wirecolor:[0,255,0]
amm7 = copy mm7 wirecolor:[0,255,0]
amm8 = copy mm8 wirecolor:[0,255,0]
amm11 = copy mm11 wirecolor:[255,0,0]
amm21 = copy mm21 wirecolor:[255,0,0]
ass = copy ss wirecolor:[255,255,0]
ag = group #(anm1,anm2,anm11,anm21,anm12,anm22,ans,am1,am3,am4,am5,am6,am7,am8,am11,am21,aas,amm1,amm3,amm4,amm5,amm6,
amm7,amm8,amm11,amm21,ass)
ag.pivot = [0,0,0]
rotate ag 60 [0,0,1]
--benzol
bm = torus radius1:7.6 radius2:1 segs:100 sides:12 position:[0,0,0] wirecolor:[0,0,255]
bm1 = copy bm wirecolor:[255,0,0]
bm2 = copy bm wirecolor:[255,0,0]
move bm1 [0 , 0, 8]
move bm2 [0 , 0, -8]
rotate bm 90 [1,0,0]
move bm [0 , 8, 0]
bm11 = torus radius1:5.5 radius2:0.75 segs:100 sides:12 position:[0,0,5.5] wirecolor:[255,0,0]
bm21 = torus radius1:5.5 radius2:0.75 segs:100 sides:12 position:[0,0,-5.5] wirecolor:[255,0,0]
bm12 = torus radius1:4 radius2:0.5 segs:100 sides:12 position:[0,0,3.5] wirecolor:[255,0,0]
bm22 = torus radius1:4 radius2:0.5 segs:100 sides:12 position:[0,0,-3.5] wirecolor:[255,0,0]
bs = sphere radius:1 segs:20 position:[0,0,0] wirecolor:[255,255,0]
bs1 = sphere radius:0.5 segs:20 position:[0,12,0] wirecolor:[255,255,0]
bg1 = group #(bm,bm1,bm2,bm11,bm21,bm12,bm22,bs,bs1)
move bg1 [0,16,0]
ungroup bg1
cm = copy bm wirecolor:[0,0,255]
cm1 = copy bm1 wirecolor:[255,0,0]
cm2 = copy bm2 wirecolor:[255,0,0]
cm11 = copy bm11 wirecolor:[255,0,0]
cm21 = copy bm21 wirecolor:[255,0,0]
cm12 = copy bm12 wirecolor:[255,0,0]
cm22 = copy bm22 wirecolor:[255,0,0]
cs = copy bs wirecolor:[255,255,0]
cs1 = copy bs1 wirecolor:[255,255,0]
cg1 = group #(cm,cm1,cm2,cm11,cm21,cm12,cm22,cs,cs1)
cg1.pivot = [0,0,0]
rotate cg1 60 [0,0,1]
bg1 = group #(bm,bm1,bm2,bm11,bm21,bm12,bm22,bs,bs1)
dm = copy bm wirecolor:[0,0,255]
dm1 = copy bm1 wirecolor:[255,0,0]
dm2 = copy bm2 wirecolor:[255,0,0]
dm11 = copy bm11 wirecolor:[255,0,0]
dm21 = copy bm21 wirecolor:[255,0,0]
dm12 = copy bm12 wirecolor:[255,0,0]
dm22 = copy bm22 wirecolor:[255,0,0]
ds = copy bs wirecolor:[255,255,0]
ds1 = copy bs1 wirecolor:[255,255,0]
dg1 = group #(dm,dm1,dm2,dm11,dm21,dm12,dm22,ds,ds1)
dg1.pivot = [0,0,0]
rotate dg1 120 [0,0,1]
em = copy bm wirecolor:[0,0,255]
em1 = copy bm1 wirecolor:[255,0,0]
em2 = copy bm2 wirecolor:[255,0,0]
em11 = copy bm11 wirecolor:[255,0,0]
em21 = copy bm21 wirecolor:[255,0,0]
em12 = copy bm12 wirecolor:[255,0,0]
em22 = copy bm22 wirecolor:[255,0,0]
es = copy bs wirecolor:[255,255,0]
es1 = copy bs1 wirecolor:[255,255,0]
eg1 = group #(em,em1,em2,em11,em21,em12,em22,es,es1)
eg1.pivot = [0,0,0]
rotate eg1 180 [0,0,1]

fm = copy bm wirecolor:[0,0,255]
fm1 = copy bm1 wirecolor:[255,0,0]
fm2 = copy bm2 wirecolor:[255,0,0]
fm11 = copy bm11 wirecolor:[255,0,0]
fm21 = copy bm21 wirecolor:[255,0,0]
fm12 = copy bm12 wirecolor:[255,0,0]
fm22 = copy bm22 wirecolor:[255,0,0]
fs = copy bs wirecolor:[255,255,0]
fs1 = copy bs1 wirecolor:[255,255,0]
fg1 = group #(fm,fm1,fm2,fm11,fm21,fm12,fm22,fs,fs1)
fg1.pivot = [0,0,0]
rotate fg1 240 [0,0,1]

gm = copy bm wirecolor:[0,0,255]
gm1 = copy bm1 wirecolor:[255,0,0]
gm2 = copy bm2 wirecolor:[255,0,0]
gm11 = copy bm11 wirecolor:[255,0,0]
gm21 = copy bm21 wirecolor:[255,0,0]
gm12 = copy bm12 wirecolor:[255,0,0]
gm22 = copy bm22 wirecolor:[255,0,0]
gs = copy bs wirecolor:[255,255,0]
gs1 = copy bs1 wirecolor:[255,255,0]
gg1 = group #(gm,gm1,gm2,gm11,gm21,gm12,gm22,gs,gs1)
gg1.pivot = [0,0,0]
rotate gg1 300 [0,0,1]

g4 = group #(ag,gg1,fg1,eg1,dg1,cg1,bg1,m1,m3,m4,m5,m6,m7,m8,m11,m21,s,mm1,mm3,mm4,mm5,mm6,mm7,mm8,mm11,mm21,ss,nm1,nm2,nm11,nm21,nm12,nm22,ns)
g4.pivot = [0,0,0]
rotate g4 60 [0,0,1]
ungroup g4
ungroup bg1
delete bm
delete bs1
ungroup cg1
delete cm
delete cs1
--ungroup dg1
--delete dm
bg1 = group #(bm1,bm2,bm11,bm21,bm12,bm22,bs)
cg1 = group #(cm1,cm2,cm11,cm21,cm12,cm22,cs)
g4 = group #(ag,gg1,fg1,eg1,dg1,cg1,bg1,m1,m3,m4,m5,m6,m7,m8,m11,m21,s,mm1,mm3,mm4,mm5,mm6,mm7,mm8,mm11,mm21,ss,nm1,nm2,nm11,nm21,nm12,nm22,ns)
g4.pivot = [0,0,0]
g4.rotation.controller[1].controller.value = 0
animate on
at time 100 g4.rotation.controller[1].controller.value = 180

262

Re: Формы, механизмы, энергия наномира - 37

Пикотехнология белков, ДНК, РНК - 2

Victoria пишет:
Kushelev пишет:

Уважаемая Виктория!

Мне хотелось бы всё-таки услышать Ваш ответ по поводу 310-спирали гонадотропина. Я хочу понять, каким образом Вы без композиционных кодов 4 сможете получить модель 310-спирали?

http://nanoworld88.narod.ru/data/209.files/0_48027_3b50efe_orig.gif
Программа Prosolver по Вашему алгоритму не показывает никакой спирали...

Как впрочем и для пи-спирали:

http://nanoworld88.narod.ru/data/288_files/0_85d09_8d7f6a3d_orig.gif

А.Ю., начнём с того, что AY307175 кодирует Ichthyomyzon unicuspis (белок, управляющий высвобождением предшественника гонадотропина: preprogonadotropin-releasing hormone III).

Собственно гонадотропин: Choriogonadotropin subunit beta (Human) является полипептидом из 165 а.о. с двумя изоформами:

>sp|P01233|CGHB_HUMAN Choriogonadotropin subunit beta OS=Homo sapiens GN=CGB PE=1 SV=1
MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPT
MTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDC
GGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ

и кодируется EMBL-CDS: AAA96690.1 :

FT   CDS             1..495
     ATGGAGATGT TCCAGGGGCT GCTGCTGTTG CTGCTGCTGA GCATGGGCGG GACATGGGCA
     TCCAAGGAGC CGCTTCGGCC ACGGTGCCGC CCCATCAATG CCACCCTGGC TGTGGAGAAG
     GAGGGCTGCC CCGTGTGCAT CACCGTCAAC ACCACCATCT GTGCCGGCTA CTGCCCCACC
     ATGACCCGCG TGCTGCAGGG GGTCCTGCCG GCCCTGCCTC AGGTGGTGTG CAACTACCGC
     GATGTGCGCT TCGAGTCCAT CCGGCTCCCT GGCTGCCCGC GCGGCGTGAA CCCCGTGGTC
     TCCTACGCCG TGGCTCTCAG CTGTCAATGT GCACTCTGCC GCCGCAGCAC CACTGACTGC
     GGGGGTCCCA AGGACCACCC CTTGACCTGT GATGACCCCC GCTTCCAGGA CTCCTCTTCC
     TCAAAGGCCC CTCCCCCCAG CCTTCCAAGC CCATCCCGAC TCCCGGGGCC CTCGGACACC
     CCGATCCTCC CACAA
//

Это белок с такой закодированной вторичной структурой:

http://img-fotki.yandex.ru/get/6304/137150420.6/0_74c53_343014d4_XL.jpg
http://fotki.yandex.ru/users/sokolik67- … ew/478291/

и таким структурным шаблоном:

http://img-fotki.yandex.ru/get/6110/137150420.6/0_74c54_f5b11a52_XL.jpg
http://fotki.yandex.ru/users/sokolik67- … ew/478292/.

Та картинка и аминокислотная последовательность, с которой Вы ко мне пристаёте, гонадотропином НЕ является. Если Вам и дальше интересно обсуждать структуру такого зверя как Ichthyomyzon unicuspis preprogonadotropin-releasing hormone III, то это в конце дня, как вернусь с работы.

Кушелев: Любопытно, но и в гонадотропине есть такая же 310-спираль:

http://img-fotki.yandex.ru/get/6301/126580004.56/0_bd38b_fc30f2d2_orig.gif
Вторичная структура гонадотропина полностью (по Кушелеву и по Соколик): http://img-fotki.yandex.ru/get/6300/126 … 9_orig.gif

Композиционный код:

1,1,1,1,1,4,4,4,4,1,4,4,4,1,1,1,4,2,1,2,1,1,1,4,3,4,2,4,1,1,
1,1,3,1,1,4,3,4,1,1,1,1,1,1,4,1,1,1,1,1,1,1,1,3,1,1,1,1,1,1,
1,1,1,4,4,1,4,1,4,4,1,4,3,1,4,4,1,1,1,1,3,4,1,1,1,1,1,4,1,3,
1,1,4,1,1,4,1,1,4,1,1,1,1,4,3,1,1,3,3,3,2,1,1,1,1,1,1,3,1,1,
4,3,1,1,1,1,1,1,1,3,3,1,1,1,1,1,1,1,3,1,2,1,1,3,1,1,1,3,2,1,
2,1,2,1,4,4,1,4,1,1,4,1,1,2,3

http://img-fotki.yandex.ru/get/6305/126580004.56/0_bd38c_744bb11c_S.gif
Оригинал: http://img-fotki.yandex.ru/get/6305/126 … c_orig.gif
Пикотехнологическая пространственная модель гонадотропина.

http://img-fotki.yandex.ru/get/6301/126580004.56/0_bd38d_5b344771_S.gif
Оригинал: http://img-fotki.yandex.ru/get/6301/126 … 1_orig.gif
Пикотехнологическая модель фрагмента (310-спирали) гонадотропина.

Вот мне и интересно знать, как Вы объясняете наличие 310-спирали в гонадотропине. Экспериментально она там обнаружена и программа "Пикотех" тоже её показывает...

263

Re: Формы, механизмы, энергия наномира - 37

http://img-fotki.yandex.ru/get/6301/126580004.56/0_bd38e_aee19b75_orig.png
Кушелев: Всё, чем могут порадовать нас специалисты по РСА (x-Ray)

А белок-то альфа-спиральный:

http://img-fotki.yandex.ru/get/6300/126580004.56/0_bd38a_c12309b9_orig.gif

Выходит, что специалисты по рентгено-структурному анализу не заметили ни одного участка спирали? smile

http://img-fotki.yandex.ru/get/6308/126580004.56/0_bd38f_81c71c46_orig.png

http://img-fotki.yandex.ru/get/6300/126580004.56/0_bd391_155f1ba9_L.png
Структура гонадотропина из википедии: http://en.wikipedia.org/wiki/CGB7

264

Re: Формы, механизмы, энергия наномира - 37

T0666

FT   CDS             1..585
     ATGCTAGGAC TTGTATTGTT ATATGTTGGG ATTGTTTTGA TCAGCAACGG GATTTGCGGA
     TTAACCAAAG TCGATCCTAA AAGCACTGCG GTGATGAACT TTTTTGTGGG CGGGCTTTCC
     ATTGTTTGTA ATGTGGTTGT CATCACTTAT TCTGCGCTCC ATCCTACAGC CCCTGTAGAA
     GGTGCAGAAG ATATTGCTCA AGTATCGCAC CATTTGACTA GCTTCTATGG GCCAGCGACT
     GGGTTATTGT TCGGTTTTAC CTACTTGTAT GCGGCTATCA ACCACACTTT TGGTTTGGAT
     TGGAGGCCCT ACTCTTGGTA TAGCTTGTTC GTAGCGATCA ACACTGTTCC TGCTGCGATT
     TTATCCCACT ATAGCGATAT GCTTGATGAC CACAAAGTGT TAGGCATCAC TGAAGGCGAT
     TGGTGGGCGA TCATTTGGTT GGCTTGGGGT GTTTTGTGGC TTACCGCTTT CATTGAAAAC
     ATCTTGAAAA TCCCTTTAGG GAAATTCACT CCATGGCTTG CTATCATTGA GGGTATTTTA
     ACCGCTTGGA TTCCTGCTTG GTTGCTCTTT ATCCAACACT GGGTG
//

Композиционный код:

1,2,2,3,2,1,3,3,3,4,3,3,1,1,1,1,4,3,1,2,3,1,3,1,3,3,3,1,3,4,
4,1,1,3,3,4,1,4,3,1,3,3,3,3,4,3,1,1,3,3,3,4,1,3,3,2,1,3,2,3,
3,2,3,3,3,3,3,2,4,1,3,1,3,1,1,3,4,2,4,3,4,3,1,1,3,3,1,1,1,3,
4,3,1,1,1,3,3,3,1,3,1,1,1,1,3,1,3,1,1,1,2,4,1,1,3,3,3,3,4,3,
3,1,1,3,1,3,1,3,3,1,1,3,4,3,1,1,3,3,1,3,1,1,4,1,3,1,1,3,1,3,
3,1,1,3,1,3,1,3,3,1,1,1,3,1,3,3,4,3,1,3,2,1,3,3,1,3,1,3,3,3,
1,3,1,3,3,3,1,1,1,3,1,3,1,1,4

http://img-fotki.yandex.ru/get/6308/126580004.56/0_bd392_cad2c034_orig.gif

265

Re: Формы, механизмы, энергия наномира - 37

T0667

FT   CDS             1..582
     ATGATGAGTA CGCTTCTATA CATTCATGGC TTTAATAGCT CACCCAGCTC GGCCAAAGCA
     ACCACCTTCA AAAGTTGGTT GCAGCAACAC CATCCCCATA TTGAGATGCA GATACCACAA
     TTACCGCCTT ATCCGGCGGA GGCCGCAGAA ATGCTGGAAA GCATCGTGAT GGATAAAGCT
     GGGCAATCCA TCGGCATTGT AGGTTCTTCC CTTGGCGGTT ATTTTGCGAC CTGGCTTTCC
     CAGCGCTTTA GTATTCCCGC AGTGGTGGTT AACCCGGCAG TGCGCCCATT CGAGCTGCTC
     AGTGATTATC TGGGGGAAAA TCAGAACCCC TACACCGGGC AAAAATATGT GTTAGAGTCT
     CGGCATATTT ACGATCTGAA AGCTATGCAG ATTGAAAAGT TGGAATCACC GGATTTACTC
     TGGTTATTGC AACAAACCGG GGATGAAGTC CTCGATTACC GTCAAGCGGT TGCCTATTAT
     ACCCCTTGTC GGCAAACAGT AGAATCAGGT GGGAATCATG CCTTTGTCGG TTTTGATCAT
     TATTTCTCCC CGATTGTGAC TTTTTTAGGG CTAGCGACCG CT
//

Композиционный код:

1,1,3,4,3,2,1,3,3,1,3,3,1,2,1,1,4,1,3,2,1,1,1,3,3,1,1,1,3,1,
3,1,3,3,1,1,1,2,2,3,3,4,3,3,4,4,1,1,2,3,1,4,3,1,1,4,1,3,3,3,
4,3,1,1,1,3,2,3,3,1,3,1,3,3,3,4,1,1,3,1,1,1,3,3,3,1,2,4,4,3,
1,4,2,4,1,2,1,1,4,1,3,3,3,4,4,3,3,1,1,1,1,1,4,3,3,3,4,3,1,3,
4,3,3,1,3,4,3,3,1,1,3,3,1,1,3,2,4,3,3,1,1,3,1,3,3,1,4,3,3,1,
1,3,1,3,3,4,3,1,3,3,1,3,3,4,3,2,2,3,2,3,4,3,3,1,3,1,3,3,3,3,
3,1,1,4,3,4,3,3,3,4,2,4,1,3

http://img-fotki.yandex.ru/get/6110/126580004.56/0_bd393_ae72039e_orig.gif

266

Re: Формы, механизмы, энергия наномира - 37

T0668

FT   CDS             1..258
     GGAAGCGAAG AGAAAGAAGA GAAAAAAGTA AGGGAACTGA CACCTCAAGA ATTAGAACTT
     TTCAAGAGGG CTATGGGGAT AACACCTCAC AATTACTGGC AGTGGGCGAG CAGGACAAAC
     AACTTTAAAC TCCTCACAGA CGGAGAATGG GTTTGGGTTG AGGGCTACGA GGAGCATATA
     GGAAAACAGC TTCCCTTAAA TCAGGCAAGG GCGTGGAGCT GGGAGTTTAT TAAAAACAGG
     CTCAAGGAGT TAAACTTG
//

Композиционный код:

2,1,3,1,3,3,1,3,3,2,1,3,4,2,3,3,3,3,3,3,1,1,1,3,1,4,2,2,3,1,
3,1,1,1,1,4,1,1,2,1,1,3,3,1,1,2,1,2,3,1,3,1,3,1,1,1,1,1,3,2,
2,3,1,3,1,3,3,1,2,1,4,1,1,1,1,3,3,3,1,1,1,1,1,3,1,1

http://img-fotki.yandex.ru/get/6302/126580004.56/0_bd394_e39116e_orig.gif

http://img-fotki.yandex.ru/get/6307/126580004.56/0_bd395_84405983_L.png
Оригинал: http://img-fotki.yandex.ru/get/6307/126 … 3_orig.png

267

Re: Формы, механизмы, энергия наномира - 37

Kushelev пишет:

Кстати, а существует ли соединение с замещением во всех 6-ти позициях?

"Гексанитробензол" из Википедии:

Производство

1. Для получения сначала кипятят ТНБ с железными опилками и соляной кислотой, либо с сульфидом аммония. Полученный 3,5-динитроанилин обрабатывают большим избытком концентрированной азотной кислоты или нитрующей смеси при 5 °C, затем температуру повышают до 70 °C. Через 4 часа смесь охлаждают до 70 °C. Пентанитроанилин (англ.)русск. C6(NO2)5NH2 отделяют с помощью сухого дихлорэтана и нитруют смесью конц. серной и азотной кислот. По другому методу пентанитроанилин окисляют перекисью водорода в большом избытке 20 % олеума при температуре 0-25 °C. Кристаллы тщательно промывают и перекристаллизовывают из сухого хлороформа.

2. Описан также способ получения, использовавшийся в Германии; он основан на восстановлении нитрогрупп тринитробензола (напр. сероводородом) до -NHOH, нитрованием конц. HNO3 до C6(NHOH)3(NO2)3 и последующим окислением смесью HNO3 и CrO3 до ГНБ.

3. более удобный способ получения пентанитроанилина — восстановление 2,4,6-тринитротолуола сероводородом до 2-амино-4,6-динитротолуола и нитрование последнего до пентанитроанилина смесью HNO3/H2SO4. Пентанитроанилин, как и ГНБ, гидролитически нестабилен.

(ТНБ - тринитробензол)

268

Re: Формы, механизмы, энергия наномира - 37

Игорь пишет:
Kushelev пишет:

Кстати, а существует ли соединение с замещением во всех 6-ти позициях?

"Гексанитробензол" из Википедии:

Производство

1. Для получения сначала кипятят ТНБ с железными опилками и соляной кислотой, либо с сульфидом аммония. Полученный 3,5-динитроанилин обрабатывают большим избытком концентрированной азотной кислоты или нитрующей смеси при 5 °C, затем температуру повышают до 70 °C. Через 4 часа смесь охлаждают до 70 °C. Пентанитроанилин (англ.)русск. C6(NO2)5NH2 отделяют с помощью сухого дихлорэтана и нитруют смесью конц. серной и азотной кислот. По другому методу пентанитроанилин окисляют перекисью водорода в большом избытке 20 % олеума при температуре 0-25 °C. Кристаллы тщательно промывают и перекристаллизовывают из сухого хлороформа.

2. Описан также способ получения, использовавшийся в Германии; он основан на восстановлении нитрогрупп тринитробензола (напр. сероводородом) до -NHOH, нитрованием конц. HNO3 до C6(NHOH)3(NO2)3 и последующим окислением смесью HNO3 и CrO3 до ГНБ.

3. более удобный способ получения пентанитроанилина — восстановление 2,4,6-тринитротолуола сероводородом до 2-амино-4,6-динитротолуола и нитрование последнего до пентанитроанилина смесью HNO3/H2SO4. Пентанитроанилин, как и ГНБ, гидролитически нестабилен.

(ТНБ - тринитробензол)

Кушелев: Любопытно... А структурные формулы o-Динитробензола и Гексанитробензола можете показать?

269

Re: Формы, механизмы, энергия наномира - 37

Пикотехнология белков, ДНК, РНК - 2

T0669


FT   CDS             1..327
     ATGAATTCTC AGAGATTAAT TCATATTAAG ACTTTAACAA CTCCAAATGA AAATGCTTTA
     AAATTTCTCT CCACAGATGG CGAGATGCTA CAGACGCGTG GCTCCAAGAG TATAGTTATT
     AAGAACACTG ATGAAAACCT CATCAACCAT TCCAAGTTAG CACAGCAAAT TTTTTTGCAG
     TGTCCAGGAG TGGAGTCTTT AATGATAGGT GATGATTTTC TCACTATTAA TAAAGACAGA
     ATGGTCCATT GGAATAGTAT CAAGCCTGAA ATTATAGATT TGTTAACCAA GCAACTTGCT
     TACGGTGAAG ATGTTATATC CAAAGAA
//

Композиционный код:

1,3,3,1,3,3,3,3,3,1,3,3,2,3,2,3,3,3,3,3,3,3,1,1,2,3,1,1,1,2,
1,4,3,1,1,1,3,2,3,3,1,1,3,3,3,1,1,1,1,3,1,1,3,2,1,3,3,3,1,1,
3,2,2,4,1,3,3,1,2,3,3,3,3,1,3,3,3,3,1,3,1,1,3,1,3,3,1,1,3,3,
3,2,3,1,3,1,1,3,3,3,1,3,3,3,3,2,1,3,

http://img-fotki.yandex.ru/get/6111/126580004.56/0_bd398_33522a8a_orig.gif

http://img-fotki.yandex.ru/get/6210/126580004.56/0_bd399_ccdf5acd_L.png
Оригинал: http://img-fotki.yandex.ru/get/6210/126 … d_orig.png

270

Re: Формы, механизмы, энергия наномира - 37

T0670

FT   CDS             1..453
     ATGGCTTCCG GCAAAGATCT TCAAGTTTCC ACATTTGGCT ACATCTCCCG CTGCCCCGTG
     CAGGTCTACG AAGCAATCGC AGATCCCAGA CAACTAGAAC GCTACTTCGC CACCGGCGGA
     GTATCTGGCC GCCTCGAAAC CGGATCGACT GTCTATTGGG ACTTCGTTGA TTTTCCCGGT
     GCGTTTCCGG TCCAAGTTGT CTCAGCTACA CAGGCTGAAC ACATTGAACT CCGCTGGGGA
     CAAGCAAATG AGCTGCGTTC CGTCAACTTC GAGTTCGAAC CTTTTAGAAA TTTCACCCGC
     ACGAAACTCA CCATCACCGA AGGCAGTTGG CCGCTCACTC CCGCAGGAGC CCAAGAGGCT
     CTGGGCAGCC AGATGGGATG GACTGGCATG CTGTCCGCAC TAAAAGCGTG GCTGGAATAC
     GGAGTGAACC TCCGCGACGG GTTTTATAAG CAA
//

Композиционный код:

1,3,1,1,3,3,3,3,3,1,2,3,1,1,1,1,1,1,1,4,1,1,1,3,2,1,2,3,1,3,
3,2,3,1,1,1,1,1,1,2,2,3,1,1,1,3,1,2,4,3,1,3,1,1,1,3,3,3,1,3,
4,3,4,1,3,3,1,2,3,2,1,3,3,1,3,3,1,1,1,2,3,2,3,1,4,3,1,1,1,1,
1,1,3,3,3,3,3,1,1,1,4,3,1,1,1,1,3,1,3,1,4,1,3,1,2,2,1,3,1,3,
4,1,1,1,1,2,1,3,1,1,4,1,2,2,3,4,1,4,3,1,2,4,1,1,1,1,4,3,3,1,
3

http://img-fotki.yandex.ru/get/6306/126580004.56/0_bd39a_edb84614_orig.gif