11

Re: Формы, механизмы, энергия наномира - 98

Формы, механизмы, энергия наномира. Сообщение 98 011

Готовится 654-ый выпуск рассылки "Новости лаборатории Наномир"

https://subscribe.ru/catalog/science.news.nanoworldnews

Дайджест:

654 Вид шкалы "Принцессы Сувсы" и "Мексиканский" через дифракционную решетку
Дифракционные матрицы Серпинского-Кушелева
Интеграция геодезии со спектральной разведкой драгметаллов
Белый лазер сегодня
Многоступенчатая селективная ионизация при добыче драгметаллов
Дифракционная шкала на основе наркотической функции Кушелева
Дифракционные геодезические шкалы с растром Жирара-Кушелева и с гексагональным растром.

https://img-fotki.yandex.ru/get/986125/158289418.4e9/0_190a2a_de676a35_XL.jpg

https://img-fotki.yandex.ru/get/910638/158289418.4ec/0_1910a5_2f42b5f1_orig.png

https://img-fotki.yandex.ru/get/1109266/158289418.4eb/0_191019_78328192_XL.jpg

https://img-fotki.yandex.ru/get/1101163/158289418.4ec/0_1910b0_2e18c4d9_orig.png

https://img-fotki.yandex.ru/get/231372/158289418.447/0_17f764_c43feaed_XL.png

https://img-fotki.yandex.ru/get/907384/158289418.4ed/0_1910ee_541e0296_orig.jpg

https://img-fotki.yandex.ru/get/963786/158289418.4ec/0_1910b3_3e15f86c_XL.jpg

https://img-fotki.yandex.ru/get/904253/158289418.4ed/0_1910cb_cbc6e863_XL.jpg

https://img-fotki.yandex.ru/get/1110316/158289418.4ed/0_1910d4_cd5d4b1b_XL.jpg

https://img-fotki.yandex.ru/get/1016661/158289418.4ed/0_1910d7_7e943740_XL.jpg

https://img-fotki.yandex.ru/get/910638/158289418.4ed/0_19115f_d1138c27_XL.png

http://nanoworld88.narod.ru/data/475_files/0_1277b5.png

https://img-fotki.yandex.ru/get/910638/158289418.4ed/0_191158_7fb277b7_XL.jpg

https://img-fotki.yandex.ru/get/1003894/158289418.4ee/0_191193_765678b0_XL.gif

12

Re: Формы, механизмы, энергия наномира - 98

ВОТ ЕЩЕ  ЛАБОРАТОРИЯ  ИЗ  УКРАИНЫ ПРЕДЛАГАЮТ СВОИ ПРОЕКТЫ - ПОСМОТРИТЕ


МЕНЯ  И ИНВЕСТОРОВ  ИЗ  КИТАЯ  И  КАНАДЫ    ИНТЕРЕСУЮТ  ДВИГАТЕЛИ  БЕЗ НЕФТИ - И АКУМУЛЯТОРЫ  ВЕЧНЫЕ...

И ЭЛ  ГЕНЕРАТОРЫ  --  БЕСТОПЛИВНЫЕ

ЭТИ ТРИ  ПОЗИЦИИ ТОЛЬКО.

СПАСИБО.

Кушелев: Если инвесторов интересует экспертиза, пусть заказывают. Или они ждут, пока кто-то проинвестирует для них эту работу? Тогда пусть ждут wink

С уважением,

13

Re: Формы, механизмы, энергия наномира - 98

Формы, механизмы, энергия наномира. Сообщение 98 006

Геодезический скрипт Кушелева

https://img-fotki.yandex.ru/get/1338015/158289418.4ed/0_191154_2aab1ff1_XL.jpg
Ещё один интересный тип дифракционных шкал...

Вероятно, такие шкалы нужно рассматривать через концентрические дифракционные решетки.

https://img-fotki.yandex.ru/get/998719/158289418.4ed/0_191155_7b886238_XL.gif
В такой решетке линии расположены радиально, а нам нужно, чтобы они располагались, как в лазерном диске.

https://img-fotki.yandex.ru/get/1026686/158289418.4ed/0_191157_23f852af_XL.jpg
Подробнее: http://bourabai.kz/physics/3326.html

В этой таблице такая решетка идёт под буквой (в).

Обратите внимание на линейный растр Жирара (и). Узнаёте?

https://img-fotki.yandex.ru/get/910638/158289418.4ed/0_191158_7fb277b7_XL.jpg
Что произойдёт, если изображение дифракционной решетки, в частности, растра Жирара, пропустить через дифракционную решетку?

Скорее всего произойдёт что-то типа этого:

https://img-fotki.yandex.ru/get/1339996/158289418.4ed/0_191159_f34052ea_XL.jpg
Это позволит точно ориентировать дифракционную решетку относительно шкалы.

Мексиканские орнаменты могут содержать окрашенные изображения растров Жирара, что позволяет точно ориентировать дифракционную решетку при обработке дифракционной шкалы.

Кушелев: Похоже, что здесь нужна не концентрическая дифракционная решетка, а гексагональная (ж)

https://img-fotki.yandex.ru/get/1003894/158289418.4ee/0_191193_765678b0_XL.gif

14

Re: Формы, механизмы, энергия наномира - 98

https://img-fotki.yandex.ru/get/901683/158289418.4ee/0_1911a9_dc9bf985_XL.jpg

15

Re: Формы, механизмы, энергия наномира - 98

Кушелев: Виктория Соколик предложила найти структуры "Монстров" первой, третьей и др. хромосом человека в базе данных PDB. Сейчас попробуем...

Начнём с музыкального белка: XP_016869648

Вот он в базе данных NCBI: https://www.ncbi.nlm.nih.gov/protein/XP_016869648.1

Вот белок с похожим названием в PDB: http://www.rcsb.org/structure/3BO8

Но первичная и соответственно вторичная структура совсем не та:

>ENA|AB021288|AB021288.1 Homo sapiens mRNA for beta 2-microglobulin, complete cds.
GGCACGAGCCGAGATGTCTCGCTCCGTGGCCTTAGCTGTGCTCGCGCTACTCTCTCTTTC
TGGCCTGGAGGCTATCCAGCGTACTCCAAAGATTCAGGTTTACTCACGTCATCCAGCAGA
GAATGGAAAGTCAAATTTCCTGAATTGCTATGTGTCTGGGTTTCATCCATCCGACATTGA
AGTTGACTTACTGAAGAATGGAGAGAGAATTGAAAAAGTGGAGCATTCAGACTTGTCTTT
CAGCAAGGACTGGTCTTTCTATCTCTTGTACTACACTGAATTCACCCCCACTGAAAAAGA
TGAGTATGCCTGCCGTGTGAACCATGTGACTTTGTCACAGCCCAAGATAGTTAAGTGGGA
TCGAGACATGTAAGCAGCATCATGGAGGTTTGAAGATGCCGCATTTGGATTGGATGAATT
CCAAATTCTGCTTGCTTGCTTTTTAATATTGATATGCTTATACACTTACACTTTATGCAC
AAAATGTAGGGTTATAATAATGTTAACATGGACATGATCTTCTTTATAATTCTACTTTGA
GTGCTGTCTCCATGTTTGATGTATCTGAGCAGGTTGCTCCACAGGTAGCTCTAGGAGGGC
TGGCAACTTAGAGGTGGGGAGCAGAGAATTCTCTTATCCAACATCAACATCTTGGTCAGA
TTTGAACTCTTCAATCTCTTGCACTCAAAGCTTGTTAAGATAGTTAAGCGTGCATAAGTT
AACTTCCAATTTACATACTCTGCTTAGAATTTGGGGGAAAATTTAGAAATATAATTGACA
GGATTATTGGAAATTTGTTATAATGAATGAAACATTTTGTCATATAAGATTCATATTTAC
TTCTTATACATTTGATAAAGTAAGGCATGGTTGTGGTTAATCTGGTTTATTTTTGTTCCA
CAAGTTAAATAAATCATAAAACTTG

И второй белок комплекса тоже к делу не относится:

http://www.uniprot.org/uniprot/P43355

>ENA|BT009789|BT009789.1 Homo sapiens melanoma antigen, family A, 1 (directs expression of antigen MZ2-E) mRNA, complete cds.
ATGTCTCTTGAGCAGAGGAGTCTGCACTGCAAGCCTGAGGAAGCCCTTGAGGCCCAACAA
GAGGCCCTGGGCCTGGTGTGTGTGCAGGCTGCCGCCTCCTCCTCCTCTCCTCTGGTCCTG
GGCACCCTGGAGGAGGTGCCCACTGCTGGGTCAACAGATCCTCCCCAGAGTCCTCAGGGA
GCCTCCGCCTTTCCCACTACCATCAACTTCACTCGACAGAGGCAACCCAGTGAGGGTTCC
AGCAGCCGTGAAGAGGAGGGGCCAAGCACCTCTTGTATCCTGGAGTCCTTGTTCCGAGCA
GTAATCACTAAGAAGGTGGCTGATTTGGTTGGTTTTCTGCTCCTCAAATATCGAGCCAGG
GAGCCAGTCACAAAGGCAGAAATGCTGGAGAGTGTCATCAAAAATTACAAGCACTGTTTT
CCTGAGATCTTCGGCAAAGCCTCTGAGTCCTTGCAGCTGGTCTTTGGCATTGACGTGAAG
GAAGCAGACCCCACCGGCCACTCCTATGTCCTTGTCACCTGCCTAGGTCTCTCCTATGAT
GGCCTGCTGGGTGATAATCAGATCATGCCCAAGACAGGCTTCCTGATAATTGTCCTGGTC
ATGATTGCAATGGAGGGCGGCCATGCTCCTGAGGAGGAAATCTGGGAGGAGCTGAGTGTG
ATGGAGGTGTATGATGGGAGGGAGCACAGTGCCTATGGGGAGCCCAGGAAGCTGCTCACC
CAAGATTTGGTGCAGGAAAAGTACCTGGAGTACCGGCAGGTGCCGGACAGTGATCCCGCA
CGCTATGAGTTCCTGTGGGGTCCAAGGGCCCTTGCTGAAACCAGCTATGTGAAAGTCCTT
GAGTATGTGATCAAGGTCAGTGCAAGAGTTCGCTTTTTCTTCCCATCCCTGCGTGAAGCA
GCTTTGAGAGAGGAGGAAGAGGGAGTCTAG

***
Вот ещё один идентификатор из PDB: http://www.rcsb.org/structure/5HVQ

Последовательность первого белка комплекса:

>ENA|BC041166|BC041166.1 Homo sapiens necdin-like 2, mRNA (cDNA clone MGC:48906 IMAGE:5730248), complete cds.
CCGACCCGCAATCCCCGCCGCGGCTGCTTGCCTACCGGAGTGTGCGCCGGCACCTGCCGC
CGGAGACATGTTGCAAAAACCGAGGAACCGGGGCCGCTCTGGCGGCCAGGCCGAGAGGGA
CAGAGACTGGAGCCATAGCGGAAACCCCGGGGCTTCGCGGGCCGGGGAAGACGCCCGGGT
TCTCAGAGACGGCTTTGCCGAGGAGGCCCCGAGCACGTCCCGCGGGCCGGGCGGCTCGCA
GGGGTCGCAGGGCCCCTCGCCTCAGGGCGCCCGCCGGGCCCAGGCCGCCCCCGCCGTGGG
GCCCAGGAGCCAGAAGCAGCTGGAGCTGAAAGTGTCCGAGCTGGTGCAGTTCTTGCTGAT
TAAAGACCAGAAGAAGATTCCGATCAAGCGGGCCGACATACTGAAGCACGTCATCGGGGA
CTACAAGGACATCTTCCCCGACCTCTTCAAACGGGCCGCCGAGCGCCTCCAGTACGTCTT
CGGGTATAAGCTGGTGGAACTTGAACCCAAGAGCAACACTTACATCCTCATCAACACCCT
GGAGCCTGTGGAGGAGGATGCCGAGATGAGGGGTGACCAAGGCACGCCCACTACGGGCCT
CCTGATGATCGTCTTAGGGCTCATCTTTATGAAGGGCAACACCATCAAGGAAACTGAAGC
CTGGGACTTTCTGCGGCGCTTAGGGGTCTACCCCACCAAGAAGCATTTAATTTTCGGAGA
TCCAAAGAAACTCATTACTGAGGACTTTGTGCGACAGCGTTACCTGGAATACCGGCGGAT
ACCCCACACCGACCCCGTCGACTACGAATTCCAGTGGGGCCCGCGAACCAACCTGGAAAC
CAGCAAGATGAAAGTTCTTAAGTTTGTGGCCAAGGTCCATAATCAAGACCCCAAGGACTG
GCCAGCGCAGTACTGTGAGGCTTTGGCAGATGAGGAGAACAGGGCCAGACCTCAGCCTAG
TGGCCCAGCTCCATCCTCTTGAAAGGTGGATTCAGAGGGACCCCCGGGACAAGGGTCTGA
GACCCAAAGGCACAGTTTAGAGGATTGGGGGAAGGGAGAACGAACCCAGGGAGCATATTG
CTGTAAACGCTTCAATGTGTGTAGCTTTAGGATGTGTTTGCAAAGTTTTGTTTTTTTAAT
GTTGTGTTATTTTGCTCCAGATTTTCATCTATAAACAAAGGAGCATTTGTTTTGATTTTA
CTCTTTTTGGTATAAAAAATTTTGCTAGCTTAGTAAAACGAATTGGAAAACTTGACTATG
ATCTGGAACAGATAATGCAAGAAGGAACACATAAGTAAGTTGCTTTGGTGCCAAGAAAAT
AAAAAAGCTATTATCAGGTCTCCTAACTACCCCAGTTTGTAAGGAAAAATAAAAGTTTTT
ATAAAATTAAAAAAAATAATTGCCTATATCCTTATTATGTTAACCTATTTTATTTTTCTA
TATTTCGTACATATATAAGTATTATTCATGGTTCCAAGCAATGAGTGTAATGTATTTTCT
CCCAATAGTAATTGTTTATATTCATAATTATTCAGCTCTGCTGCTAAACACGTAGTTCCA
CTTCGTTTTTTTCTTCTTGCTACTGTAGTTATTACAATAAATACTGTATTTTTGAAGCAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAA

Кушелев: Тут мы видим код полилизинового хвоста. А что в PDB?

https://img-fotki.yandex.ru/get/1026686/158289418.4ee/0_1911aa_a98ec5bc_XL.png
Аминокислотная последовательность имеет длину более 570 аминокислотных остатков, а в PDB, как я понял, показано меньше 300...

А это значит, что рентгенологи не видят половину белка... Тут уже не до лизиновых хвостов smile

Второй белок комплекса тоже с лизиновым хвостом (коротеньким): http://www.uniprot.org/uniprot/Q8WV22

>ENA|AF161451|AF161451.1 Homo sapiens HSPC333 mRNA, partial cds.
CCGTATCCGCAGGCGCGACCGTGGGATGCGCTTGGGCTCCCTGTTCGTTCCCACATGCAG
GGCAGCACAAGGAGAATGGGCGTCATGACTGATGTCCACCGGCGCTTCCTCCAGTTGCTG
ATGACCCATGGCGTGCTAGAGGAATGGGACGTGAAGCGCTTGCAGACGCACTGCTACAAG
GTCCATGACCGCAATGCCACCGTAGATAAGTTGGAGGACTTCATCAACAACATTAACAGT
GTCTTGGAGTCCTTGTATATTGAGATAAAGAGAGGAGTCACGGAAGATGATGGGAGACCC
ATTTATGCGTTGGTGAATCTTGCTACAACTTCAATTTCCAAAATGGCTACGGATTTTGCA
GAGAATGAACTGGATTTGTTTAGAAAGGCTCTGGAACTGATTATTGACTCAGAAACCGCT
TTGCGTCTTCCACAAACATATTGAACCTGGTGATCAACTTAAAGGCAAGAATAAGAAGGA
AAGAAGGAAGCCGAGCAGGTGCTGCAGAAGTTTGTTCAAAACAAGTGGCTGATTGAGAAG
GAGGGGAGTTCACCCTTGGACGGGCCGGGCCATCCTGGAGATGGAGCAATACATCCGGGA
GACGTACCCCGACGCGGTGAAGATCTGCAATATCTGTCACAGCCTCCTCATCCAGGGTCA
AAGCTGCGAAACCTGTGGGATCAGGATGCACTTACCCTGCGTGGCCAAGTACTTCCAGTC
GAATGCTGAACCGCGCTGCCCCCACTGCAACGACTACTGGCCCCACGAGATCCCAAAAGT
CTTCGACCCTGAGAAGGAGAGGGAGTCTGGTGTCTTGAAATCGAACAAAAAGTCCTGCGG
TCCAGGCAGCATTAGCCATCGTGCCCTGCTGAGGGGCTGGCTGCCTTGAGTGGCCTGATC
GCCACAGCCCTTCTTGGAAGAAAGGCGTCCGTGTTTCAGGTTCCACGCGAGTCACCTCTT
TCGTCTTAATGTTCACCGTCCACAGCTTTGGAATAAACCATCCTGGGAAGTTAAAAAAAA
AAAAAAAAAAAAAAAAAA

https://img-fotki.yandex.ru/get/1017047/158289418.4ee/0_1911ab_78fcc67a_XL.png
И про вторичную структуру лизинового хвостика опять ничего неизвестно...

16

Re: Формы, механизмы, энергия наномира - 98

Название вроде такое же, а последовательность другая...

https://www.uniprot.org/uniprot/Q9UJ55.fasta

>sp|Q9UJ55|MAGL2_HUMAN MAGE-like protein 2 OS=Homo sapiens OX=9606 GN=MAGEL2 PE=1 SV=2
MSQLSKNLGDSSPPAEAPKPPVYSRPTVLMRAPPASSRAPPVPWDPPPIDLQASLAAWQA
PQPAWEAPQGQLPAPVVPMTQPPALGGPIVPAPPLGGPMGKPPTPGVLMVHPPPPGAPMA
QPPTPGVLMVHPSAPGAPMAHPPPPGTPMSHPPPPGTPMAHPPPPGTPMAHPPPPGTPMV
HPPPPGTPMAHPPPPGTPMAHPPPPGTPMAHPPPPGTPMAHPPPPGTPMAQPPAPGVLMA
QPLTPGVLMVQPAAPGAPMVQPPPAAMMTQPQPSGAPMAKPPGPGVLMIHPPGARAPMTQ
PPASGAPMAQPAAPPAQPMAPPAQPMASWAPQAQPLILQIQSQVIRAPPQVPQGPQAPPA
QLATPPGWQATSPGWQATQQGWQATPLTWQTTQVTWQAPAVTWQVPPPMRQGPPPIRPGP
PPIRPGPPPVRQAPPLIRQAPPVIRQAPPVIRQAPPVIRQAPAVIRQAPPVIRQAPPVIR
QAPPVIRQAPPLIRQAPPPIRPAPQVLATQPPLWQALPPPPPLRQAPQARLPAPQVQAAP
QVPTAPPATQVPAAPPAGPQVPQPVLPAPLSAPLSAPQAVHCPSIIWQAPKGQPPVPHEI
PTSMEFQEVQQTQALAWQAQKAPTHIWQPLPAQEAQRQAPPLVQLEQPFQGAPPSQKAVQ
IQLPPQQAQASGPQAEVPTLPLQPSWQAPPAVLQAQPGPPVAAANFPLGSAKSLMTPSGE
CRASSIDRRGSSKERRTSSKERRAPSKDRMIFAATFCAPKAVSAARAHLPAAWKNLPATP
ETFAPSSSVFPATSQFQPASLNAFKGPSAASETPKSLPYALQDPFACVEALPAVPWVPQP
NMNASKASQAVPTFLMATAAAPQATATTQEASKTSVEPPRRSGKATRKKKHLEAQEDSRG
HTLAFHDWQGPRPWENLNLSDWEVQSPIQVSGDWEHPNTPRGLSGWEGPSTSRILSGWEG
PSASWALSAWEGPSTSRALGLSESPGSSLPVVVSEVASVSPGSSATQDNSKVEAQPLSPL
DERANALVQFLLVKDQAKVPVQRSEMVKVILREYKDECLDIINRANNKLECAFGYQLKEI
DTKNHAYIIINKLGYHTGNLVASYLDRPKFGLLMVVLSLIFMKGNCVREDLIFNFLFKLG
LDVRETNGLFGNTKKLITEVFVRQKYLEYRRIPYTEPAEYEFLWGPRAFLETSKMLVLRF
LAKLHKKDPQSWPFHYLEALAECEWEDTDEDEPDTGDSAHGPTSRPPPR

17

Re: Формы, механизмы, энергия наномира - 98

Формы, механизмы, энергия наномира. Сообщение 98 017

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-04-23 001:

http://www.uniprot.org/uniprot/Q9QZ04.fasta

>sp|Q9QZ04|MAGL2_MOUSE MAGE-like protein 2 OS=Mus musculus OX=10090 GN=Magel2 PE=1 SV=2
MSQLSTNLGDSSPPESPVPAVHSRPTVLMRAPPASSRAPPVPWDPPPVDLQAPMAAWQAP
QPAWEAPEGQLPAPVAQLAQPPGLGAPMVQAPPLGGGMAKPPTPGVLMVHQPPPGAPMAQ
SSTPGVLMLHPSVTGAPLAHPPPPGTPMTHPPGTSMAHPPPPPPPPPPPPPPGTPMTHPP
PPGTPMGHHPPPGNPMTHPPPGNPMVHPLTHGAPMVHGGPHGTPMPHVPITGTPIAQQPT
PGVLMAQQLTPGVLMVQPPAPGAPMVQPPPQAALMTQPAPSITPMAKPPGPGVVMIHPPG
ARGPIIQTPVSGAPMAQTVLPPGQPLATWAPQGQPLILQIQSQVIRAPPQVPSVPQAPQV
QLATPPGWQATTPNWQVTPQGWPATPLTWQATQVTWQAPTIAWQATQPGRQGHSTIRTGH
TPIRPGPAPLLRQIPPMIRQIQPVMRQAPPLIRQVPIRPAPHGIASQPQLWQVLPPPPPL
RQAPQARLLLPRVPGTGQVSTVPPVAQIHLVPQSGPQVPQTVLPAQLSIPIPVPQAAAQS
APRTVHCPPIIWQAPKGQAPVPQELPVPQELPVPQELPVPQEVPVPQEIPVPQEIPVPQE
LPVPQELPVPQELPVPQELPVPQELPVPQELPVPQELPVPQELPVPLEFQEVQQAQAVGW
RAPKVPPHFWQPVSAQEAQEQATQIAHVEQQQPFQGAPASSKALQTQLPTHQAQASGLQA
ELPSVQLQPSWQGPLPMLQAQPGASATLANFPRGSTRSRMAPSGEPGPSSLEPRGPPRER
RAPARDKKGPPKERMFIGATFCAPRGASASRAYVPTAWKNLPATSETFPATSRVFPSTSH
FQPASSNAFRGPSAASESPKSLPFALQDPYACVEALPAVPWVPYPDGNASSACKSVPAIL
MVAAAAPQASATAAEASKSSEPPRRPGKATRKKKHLEPKEDNCGHRLSSRDWRGPRTWGN
PSHSDWEIQRAMQLLGDRESLYTPQGLNDWGCPNTSRMPRSLEGPSTSRDQEFCGDSGGS
QTWMASEVPSVSRGSSAAQEDPDRESQPLSPLDERANALVQFLLVKDQAKVPVQLSEMVN
VVIREYKDDSLDIINRANTKLECTFGCQLKEVDTKTHTYIIVNKMAYPQCNLLASYLERP
KFSLLMVVLSLIFMKGYCIRENLLFSFLFQLGLDVQETSGLFRITKKLITSVFVRHRYLE
YRQIPFTEPAEYELLWGPRAFLETNRVHILRFLAALYENQPQIWSCQYLDSLAELEYKDA
NAAAEESHDSDDDAHDPTSSPHPH

Кушелев: Тут уже видна повторяющаяся последовательность, т.е. похоже на наличие программной спирали.

https://www.ebi.ac.uk/ena/data/view/AJ2 … play=fasta

>ENA|AJ243608|AJ243608.1 Mus musculus mRNA for ns7 protein, ortholog of the human nM15 gene.
AACTCAGCTGCCGACCCACCAGGCCCAAGCCTCTGGCTTGCAGGCAGAACTGCCTTCAGT
GCAGCTGCAGCCTTCTTGGCAAGGCCCACTGCCCATGTTGCAGGCCCAGCCTGGAGCCTC
TGCCACACTGGCAAACTTTCCCCGGGGCTCCACTCGATCACGTATGGCTCCATCAGGAGA
ACCTGGCCCCTCTTCTCTAGAACCTCGGGGCCCTCCTAGGGAACGTAGGGCACCTGCAAG
GGACAAAAAGGGTCCTCCAAAAGAGCGCATGTTCATTGGTGCCACTTTCTGTGCTCCAAG
GGGGGCATCAGCATCCAGGGCATACGTGCCAACTGCCTGGAAAAACTTGCCTGCCACATC
AGAGACCTTTCCTGCCACCTCAAGGGTCTTTCCATCTACCTCTCATTTCCAGCCTGCCTC
TTCTAATGCCTTTAGAGGTCCATCTGCCGCCTCAGAGAGCCCAAAGTCACTGCCATTTGC
TCTGCAGGATCCTTATGCCTGCGTAGAGGCCCTGCCTGCAGTTCCCTGGGTTCCGTATCC
AGATGGAAATGCCTCATCAGCATGTAAGTCAGTGCCTGCCATCTTGATGGTGGCAGCAGC
TGCCCCCCAGGCAAGTGCCACTGCTGCAGAGGCCTCTAAGTCTTCAGAGCCGCCAAGACG
CCCCGGCAAAGCCACCAGGAAGAAGAAGCATCTGGAACCCAAAGAAGACAACTGTGGCCA
CAGGCTCTCCTCACGTGACTGGCGGGGGCCCCGAACCTGGGGCAATCCCAGTCATTCTGA
CTGGGAGATTCAGAGGGCTATGCAGCTCCTGGGGGACCGGGAATCCCTCTACACTCCGCA
GGGCCTGAATGACTGGGGGTGCCCCAACACTTCTAGGATGCCAAGGAGCTTGGAGGGCCC
TAGCACTTCACGGGACCAGGAATTCTGTGGTGACTCGGGTGGGTCTCAGACATGGATGGC
TTCTGAGGTCCCAAGCGTCTCTCGGGGATCCAGTGCTGCTCAGGAGGACCCTGATAGGGA
GAGTCAGCCCTTATCTCCCTTAGATGAGAGAGCAAACGCTTTGGTGCAGTTTCTCTTGGT
CAAAGACCAAGCCAAGGTGCCTGTCCAGCTCTCGGAGATGGTAAATGTTGTCATCCGAGA
ATACAAAGACGACAGCTTAGACATCATCAACCGTGCCAACACTAAGCTGGAGTGCACCTT
TGGTTGTCAACTGAAGGAAGTTGACACCAAAACCCACACTTACATCATCGTCAACAAGAT
GGCGTACCCTCAGTGTAATTTGCTGGCATCCTATTTAGAGAGGCCAAAGTTCAGCCTCCT
GATGGTGGTCTTGAGCCTCATCTTTATGAAAGGCTACTGTATCAGGGAGAATCTGCTCTT
TAGTTTTCTGTTCCAGCTAGGGCTGGATGTCCAGGAGACAAGTGGTCTCTTCAGAATTAC
AAAGAAGCTCATCACCAGTGTGTTTGTGAGACACAGGTACCTAGAGTACAGGCAAATCCC
GTTCACTGAGCCTGCAGAATACGAGCTTCTCTGGGGGCCCCGGGCATTCCTCGAAACCAA
CAGGGTGCACATCTTGAGATTTTTGGCCGCACTCTACGAGAACCAGCCCCAGATCTGGTC
ATGCCAGTACCTTGACTCACTGGCAGAGTTAGAATACAAGGACGCAAATGCCGCCGCCGA
AGAGTCCCATGACAGCGATGATGATGCCCACGACCCCACCAGCAGTCCCCATCCTCACTA
ATAGACGTTACTAAGATGATTTTTATACTTGTGGGTCCAAAGCCAAAGGCAAAAGACAAT
GGGGGGTGGGGGACATTGTGCTTTCTGGTGTTTTTTGGTATTGTTCTCTGTGTATAAATT
TTACAGCCTGTTTTTATATTTGCCAAAGCTTTTGTACAGTTTTGTGAAATGTTGATTTAA
ACTGGCTGCTGTATTGTTTTGTATTTTGGTGTCTGTATTTTTTTAAATGAGATCTGTGAT
TCCCTGTTTGGTGTACTAATTGTAATGTTACAGTATCAGAGTTGTGCTGCCTTGTGTGTG
AAAAGAAATGACAGTTTATTTGTCTCGTTTTGTTTATGTAAAATCAGAATGTTTTTGGAT
GTTAATATGACTCATCGGTAAAATACTGTCTGGAGAAAAGTAAAGATCAATACTATATAA
ATATACTTTTAGCATAAAAA

Этот файл ошибочный. Он кодирует стоп-кодоны в структуре белка.

Вот исправленный, сделанный вручную:

>ENA|AJ243608|AJ243608.1 Mus musculus mRNA for ns7 protein, ortholog of the human nM15 gene.
atgttcattggtgccactttctgtgctccaaggggggcatcagcatccagggcatacgt
gccaactgcctggaaaaacttgcctgccacatcagagacctttcctgccacctcaagggt
ctttccatctacctctcatttccagcctgcctcttctaatgcctttagaggtccatctgc
cgcctcagagagcccaaagtcactgccatttgctctgcaggatccttatgcctgcgtaga
ggccctgcctgcagttccctgggttccgtatccagatggaaatgcctcatcagcatgtaa
gtcagtgcctgccatcttgatggtggcagcagctgccccccaggcaagtgccactgctgc
agaggcctctaagtcttcagagccgccaagacgccccggcaaagccaccaggaagaagaa
gcatctggaacccaaagaagacaactgtggccacaggctctcctcacgtgactggcgggg
gccccgaacctggggcaatcccagtcattctgactgggagattcagagggctatgcagct
cctgggggaccgggaatccctctacactccgcagggcctgaatgactgggggtgccccaa
cacttctaggatgccaaggagcttggagggccctagcacttcacgggaccaggaattctg
tggtgactcgggtgggtctcagacatggatggcttctgaggtcccaagcgtctctcgggg
atccagtgctgctcaggaggaccctgatagggagagtcagcccttatctcccttagatga
gagagcaaacgctttggtgcagtttctcttggtcaaagaccaagccaaggtgcctgtcca
gctctcggagatggtaaatgttgtcatccgagaatacaaagacgacagcttagacatcat
caaccgtgccaacactaagctggagtgcacctttggttgtcaactgaaggaagttgacac
caaaacccacacttacatcatcgtcaacaagatggcgtaccctcagtgtaatttgctggc
atcctatttagagaggccaaagttcagcctcctgatggtggtcttgagcctcatctttat
gaaaggctactgtatcagggagaatctgctctttagttttctgttccagctagggctgga
tgtccaggagacaagtggtctcttcagaattacaaagaagctcatcaccagtgtgtttgt
gagacacaggtacctagagtacaggcaaatcccgttcactgagcctgcagaatacgagct
tctctgggggccccgggcattcctcgaaaccaacagggtgcacatcttgagatttttggc
cgcactctacgagaaccagccccagatctggtcatgccagtaccttgactcactggcaga
gttagaatacaaggacgcaaatgccgccgccgaagagtcccatgacagcgatgatgatgc
ccacgaccccaccagcagtccccatcctcactaat

https://img-fotki.yandex.ru/get/1003446/158289418.4ee/0_1911ac_db9a337f_orig.png
В этом белке попался семидольный ритм, но структура не периодическая...

18

Re: Формы, механизмы, энергия наномира - 98

Вот другой белок похоже с периодической вторичной структурой:

https://www.uniprot.org/uniprot/Q9UJ55.fasta

>sp|Q9UJ55|MAGL2_HUMAN MAGE-like protein 2 OS=Homo sapiens OX=9606 GN=MAGEL2 PE=1 SV=2
MSQLSKNLGDSSPPAEAPKPPVYSRPTVLMRAPPASSRAPPVPWDPPPIDLQASLAAWQA
PQPAWEAPQGQLPAPVVPMTQPPALGGPIVPAPPLGGPMGKPPTPGVLMVHPPPPGAPMA
QPPTPGVLMVHPSAPGAPMAHPPPPGTPMSHPPPPGTPMAHPPPPGTPMAHPPPPGTPMV
HPPPPGTPMAHPPPPGTPMAHPPPPGTPMAHPPPPGTPMAHPPPPGTPMAQPPAPGVLMA
QPLTPGVLMVQPAAPGAPMVQPPPAAMMTQPQPSGAPMAKPPGPGVLMIHPPGARAPMTQ
PPASGAPMAQPAAPPAQPMAPPAQPMASWAPQAQPLILQIQSQVIRAPPQVPQGPQAPPA
QLATPPGWQATSPGWQATQQGWQATPLTWQTTQVTWQAPAVTWQVPPPMRQGPPPIRPGP
PPIRPGPPPVRQAPPLIRQAPPVIRQAPPVIRQAPPVIRQAPAVIRQAPPVIRQAPPVIR
QAPPVIRQAPPLIRQAPPPIRPAPQVLATQPPLWQALPPPPPLRQAPQARLPAPQVQAAP
QVPTAPPATQVPAAPPAGPQVPQPVLPAPLSAPLSAPQAVHCPSIIWQAPKGQPPVPHEI
PTSMEFQEVQQTQALAWQAQKAPTHIWQPLPAQEAQRQAPPLVQLEQPFQGAPPSQKAVQ
IQLPPQQAQASGPQAEVPTLPLQPSWQAPPAVLQAQPGPPVAAANFPLGSAKSLMTPSGE
CRASSIDRRGSSKERRTSSKERRAPSKDRMIFAATFCAPKAVSAARAHLPAAWKNLPATP
ETFAPSSSVFPATSQFQPASLNAFKGPSAASETPKSLPYALQDPFACVEALPAVPWVPQP
NMNASKASQAVPTFLMATAAAPQATATTQEASKTSVEPPRRSGKATRKKKHLEAQEDSRG
HTLAFHDWQGPRPWENLNLSDWEVQSPIQVSGDWEHPNTPRGLSGWEGPSTSRILSGWEG
PSASWALSAWEGPSTSRALGLSESPGSSLPVVVSEVASVSPGSSATQDNSKVEAQPLSPL
DERANALVQFLLVKDQAKVPVQRSEMVKVILREYKDECLDIINRANNKLECAFGYQLKEI
DTKNHAYIIINKLGYHTGNLVASYLDRPKFGLLMVVLSLIFMKGNCVREDLIFNFLFKLG
LDVRETNGLFGNTKKLITEVFVRQKYLEYRRIPYTEPAEYEFLWGPRAFLETSKMLVLRF
LAKLHKKDPQSWPFHYLEALAECEWEDTDEDEPDTGDSAHGPTSRPPPR

Опять файл fasta с ошибками. Вот исправленный:

>ENA|AJ243531|AJ243531.1 Homo sapiens mRNA for nM15 protein
atgcagggcctcttctatagaccgcagggctcctctaaagagcgcaggacctcctcgaag
gagcgcagggccccttcaaaagaccgcatgatctttgctgccaccttctgtgctcccaag
gcagtgtcagctgcgcgagcacacctgccagctgcctggaaaaacctgcctgccacaccg
gagacctttgctccctcctcaagtgtcttcccagctacctcccagtttcagcctgcctct
ctgaatgcctttaaaggcccctctgctgcctcagagaccccaaagtcactgccatatgct
ctgcaggatccctttgcctgtgtagaggccctgcctgcagttccatgggtcccacagccc
aatatgaatgcctcaaaggcatcgcaggcagtgcccaccttcctgatggctacagcagct
gccccccaggcaactgccaccactcaagaggcctccaagacctccgtcgagccgccacgc
cgctccggcaaggccacccggaagaagaagcatctggaagcccaagaggacagccgtggc
cacacgctagcctttcatgactggcagggcccaaggccctgggagaatctaaatctgagt
gactgggaggtccaaagccctatccaggtctcgggtgactgggagcacccaaacaccccc
cgtggcctgagtggttgggagggccctagcacctccaggatcctgagtggctgggaaggg
cccagcgcatcctgggccctgagtgcctgggagggcccgagcacctccagggccctgggt
ctctctgaaagcccagggagctctctgcccgtagttgtgtctgaggtcgcaagtgtctct
ccgggatccagtgccacccaggataattccaaggtggaggcacagcccttgtctcccttg
gatgagagggcaaatgcgttggtgcagttcctcttagtcaaggaccaagccaaggtgcct
gtccagcgctcggagatggtgaaagtcatcctccgagagtataaagatgagtgcttagat
atcatcaaccgtgccaacaataagctggagtgtgcctttggttatcaattgaaagaaatt
gataccaaaaaccacgcctatattatcatcaacaagctgggctaccatacagggaatttg
gtggcatcctatttagacaggcccaagtttggccttctgatggtggtcttgagcctcatc
tttatgaaaggcaactgtgtcagggaggatctgatctttaattttctgttcaagttaggg
ttggatgtccgggagacaaacggtctctttggaaatactaagaagctcatcaccgaagtg
tttgtcaggcagaagtacctagagtacaggcgaatcccttacactgagcccgcagagtat
gagttcctctggggccctcgagcattcctggaaaccagcaagatgcttgtcctgaggttt
ttggccaagctccataagaaagatccacagagctggccattccattaccttgaagcgctc
gcagagtgtgagtgggaagacacagatgaggatgaacctgacaccggtgacagtgcccac
ggccccaccagcaggccccctccccgctaataggtgtagcagagatctcgctcctgtgtt
tccctggccagaggccactgacagggtggggggacatttttgttcctggtgtttgtgttc
cagttccacgagtgtaagtttggattttcaacttggtttcgtatctgccaaagctttgta
cattttttatgtggtgttgatttcaatcggctactgttctgttctgtattttggcatctg
tgtttttaagtgagatctgtggttctctgttttgtgttataattgttatgttttggtatc
agctttgtgctggctttgtgaaatgaattgagaagctatccatctcatttctggtatagt
tcatgtagcattgtaatcggttgttctttgaacgttcaaatgactcatcagtaaaaactg
tctacagagaagtaaatatctatatctatatatataaatatactttcagcataac

Первичная последовательность снова не соответствует заявленной... Она кодирует непереодическую структуру другого белка.

19

Re: Формы, механизмы, энергия наномира - 98

Вот что по этому поводу написано в википедии: https://www.wikigenes.org/e/gene/e/54551.html

https://img-fotki.yandex.ru/get/896349/158289418.4b9/0_18a0fd_f166188_orig.png
Подробнее: http://nanoworld.org.ru/topic/1699/page/78/

А для этого музыкального белка структуру в PDB (и её окрестностях) найти не удаётся...

20

Re: Формы, механизмы, энергия наномира - 98

Инвестор А пишет:

Кушелев: Если прототип Emdrive инвестора не устраивает, это не наш инвестор smile
С уважением,


Инвестор А: КУШЕЛЕВ  --  А  ГДЕ ИНВЕСТОР  МОЖЕТ УВИДИТЬ - ПОЩУПАТЬ ЭТУ  ХРЕНЬ ?

А БЕЗ ОЗНАКОМЛЕНИЯ  - ОН НЕ ДАСТ ДЕНЕГ...

ЧТО  ЖЕ ТЫ  ЗА 25 ЛЕТ НЕ НАШЕЛ  СВОЕГО ИНВЕСТОРА  ??7

Кушелев: Инвестор может пощупать эту хрень на околоземной орбите. Или посмотреть китайское ТВ, где показывают космический аппарат с Emdrive. Мой Ruby Emdrive инвестор может пощупать,

http://img-fotki.yandex.ru/get/5819/158 … a2c3_L.gif

Подробнее: http://nanoworld.org.ru/topic/1707/

но чтобы его включить, нужен магнетрон 8-мм диапазона с модулятором. Это, конечно, не 70 миллионов USD стоит, а только 100 000, а эксперимент на Заводе обойдётся инвестору явно меньше любой серьёзной экспертизы. Всего пол миллиона рублей.

С уважением,