21

Re: Музыка сборки белка в профессиональной аранжировке

Здравствуйте, Мастер! Игорь прислал комплект файлов для Logic-X: https://yadi.sk/d/GTfIXpk43VMLXj
MIDI он сохранить не может.
Сможете установить программу Logic-X и открыть музыкальный проект?

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/WIKARxD93VMNUJ

22

Re: Музыка сборки белка в профессиональной аранжировке

Музыка сборки белка в профессиональной аранжировке

Кушелев: ... Специалист хочет некоторые инструменты заменить на более качественные. Тогда и wav, и mp3 должны зазвучать лучше. Послушаем, почему бы и нет?

согласен живой инструмент он и в Африке - живой )) мне тоже больше нравится на рояле играть чем на синтезаторе , здрав будь , что получится скинь пожалуйста мне интересно послушать у дачи

Кушелев: Здравствуйт, Игорь!
Мой знакомый музыкант пытался играть по нотам, которые ты прислал, но он говорит, что там ноты сильно упрощённые по отношению к тем, что слышны в файле mp3. Даже мелизмов в нотах нет, а про более мелкие нюансы "вообще молчу".

А ты не пытался сохранить файл MIDI с указанием "Экспорт миди / сохранять каждый инструмент в отдельном канале миди" ?

А знакомый специалист по MIDI пытается поставить на свой Мак Logic-X, чтобы открыть проект, который ты прислал: http://nanoworld.org.ru/topic/1930/page/3/

Посмотрим, сможет ли он открыть проект?

Удачи!

23

Re: Музыка сборки белка в профессиональной аранжировке

Формы, механизмы, энергия наномира. Сообщение 99 748

"Рождение" и "жизнь" белковых молекул - новые музыкальные стили

Те, кто не слышал музыку, под которую строится или "рождается" белковая молекула, могут скачать её в профессиональной аранжировке по адресу, опубликованному в этой теме: http://nanoworld.org.ru/topic/1930/

В чем отличие новых стилей музыки "рождения" и "жизни" белковых молекул?

В действительности этой музыке более 3 миллиардов лет, поэтому новая она лишь для тех, кто раньше её не слышал.

В процессе сборки ("рождения") белковой молекулы ноты звучат последовательно, т.к. последовательно присоединяются аминокислотные остатки к растущей структуре белковой молекулы.

В процессе функционирования активных центров белковой молекулы могут звучать аккорды. Двузвучия, трезвучия и более сложная полифония.

Учитывая, что сборка и функционирование происходят параллельно, в некоторых зонах рядом с рибосомой можно "слышать" одновременно оба стиля музыки.

Компьютерное моделирование помогает услышать этот невероятный молекулярный музыкальный "концерт".

В процессе аранжировки профессиональный музыкант, Игорь Ащеулов интуитивно соединил эти два необычных музыкальных стиля в одном произведении.

Самое любопытное, что эта музыка сборки и функционирования белковых молекул воспринимается как вполне обычная музыка, напоминающая современный фольклор...

Однако наука не стоит на месте, поэтому скоро Вы увидите развитие этой темы...

24

Re: Музыка сборки белка в профессиональной аранжировке

Формы, механизмы, энергия наномира. Сообщение 102 704

Музыка сборки белка в профессиональной аранжировке

Приглашаю спонсоров, инвесторов, меценатов для съемки музыкального клипа "Рождение молекулы".

Напомню, что Игорь Ащеулов сделал профессиональную аранжировку музыки сборки программной спирали белка: http://nanoworld.org.ru/topic/1930/

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/a9rjesp5b1Y-Zw

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/EaBCi4d2vrogNA

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/h6Dz_M_2XFspSg

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/O2pzXUxXKFCgWg

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/qE8vCg92VORbTQ

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/YHtvCVcwlYKXFg

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/g5Ziqs5sIr1XjA

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/xoyNTU7_yPFlAg

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/re0OInbSpxhaxw

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/buiuuShsAkqptA

25

Re: Музыка сборки белка в профессиональной аранжировке

Музыка сборки белка в профессиональной аранжировке

Формы, механизмы, энергия наномира. Сообщение 102 925

Ищем программную спираль по ... ритму!

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-10_002:

RCH94596

https://www.ncbi.nlm.nih.gov/protein/RC … B8UV0D701R

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/IO5LSg8smbaf7g
Развернуть: https://yadi.sk/i/YS6rAKaWPlR5og

Ближе к концу попалась такая музыкальная фраза:

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/rnr_-jj3JNLiMA

Так эта музыка звучит в аранжировке Кушелева (mp3): https://yadi.sk/d/Wkoo3vI6F6lp9w

Кто бы мог подумать, что миллиарды лет назад на нашей планете уже звучала достаточно сложная музыка с подобными музыкальными фразами. Но звучала она в гиперзвуковом диапазоне в недрах "черных курильщиков"...

26

Re: Музыка сборки белка в профессиональной аранжировке

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-10_006: PPGPPGPPGPPGPPGPPGPPGPPGPPGPPG

https://www.ncbi.nlm.nih.gov/protein/XP … DT3PUA3015

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/PbtjGRxGQC2E2g

Развернуть: https://yadi.sk/i/ZdZvJFxZeNoQSQ

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/HZZAKB7tYxAEPg
В нотах сборки этого белка встречается любопытный фрагмент. Это не только 5 первых нот из песенки "Чижик-пыжик, где ты был?": https://www.youtube.com/watch?v=UWyUs-cX9zI

но и фрагмент из детской песенки, которая звучит в фильме "Джентльмены удачи": https://www.youtube.com/watch?v=2idlZXlDI_8

Песенка начинается почти с этих же 5 нот, правда, отличие на одну (вторую) ноту всё же у этих двух песен есть. Поэтому скорее всего ноты для них композиторы взяли из похожих фрагментов, но разных белков...

Заказ 2018-11-10_007: PPGPPGPPGPPGPPGPPGPPGPPGPPGPPG

https://www.ncbi.nlm.nih.gov/nuccore/XM … port=fasta

>XM_006814125.1 PREDICTED: Saccoglossus kowalevskii collagen alpha-5(IV) chain-like (LOC102802964), mRNA
ATGCCAAATGAAGATTTATTGTGCATGTATTATGAAGGATTTGGCATTAGACACTTACTTGGCCCTCCTG
GTCCACCTGGTCCACCGGGTCCACCAGGTCCCCCTGGTCCTCCTGGTCCACCTGGTTCACCAGGTTCTGC
CATTGCAGAAGTTTTACCTGTACTCAGTTCAGGTCCGCCTGGTCCACCAGGACCACCAGGACCAAATGGT
CCTCCAGGACCACCAGGTCCAAATGGCCCTCCTGGGCCAAAAGGACCACCAGGTCCTCCAGGTCCACCTG
GTCCACCTGGTCCTCCAGGACCTCCAGGTCCTCCAGGACCACCAGGACCCAACGGTCCTAATGGTTCACC
AACATTATCCGGAATTTCTAGTTCTTCTTCTGGTGTAGGTGTGGGTCCGCCTGGTCCACCAGGCCCATTT
GGTCCACCTGGTCCATTTGGACCTCCAGGTCCATTTGGCCCTCCTGGTCCATTTGGTCCTCCAGGGCCAT
CAGGCCCACCTGGTCCACCTGGACCTTGTGGGCCCCCTGGGCCACCGGGTCCACCTGGACCTCCTGGTTT
TCCCACATCAGGAGGTGTTGTCTCATCTGTAGCAAGGGTTGGTCCTCCCGGCCCTCCTGGTCCTCCAGGG
CCCCCTGGTCCACCTGGCCCTCCAGGTCCTCCAGGTCCACCTGGACCAAGTGGCTTCCCAGGATCACCAA
TGTCTTCTGGATTGACTTCAGGTCCACCTGGTCCTTCCGGCCCACCTGGACCTCCAGGTCCACCAGGTCC
AAACGGCCCTCCAGGACCTCCAGGTCCAAATGGCCCTCCTGGGCCAAAAGGTCCACCAGGTCCACCACTT
ACACCGATGTCATCAGGTAAAGTAACTCCAGGAGCCAAAGATGGTCCATCAGGCCCTCCTGGTCCATCAG
GTCCACCTGGTCCCCCTGGTCCTCCAGGACCCCCAGGCCCTCCTGGCCCACCAGGTCCACCTGTTGGAGA
ACCAATATATTTAAAACTAAGTATACATGTCTTACCTGGACCTCCAGGACCTCCAGGACCGCCTGGTCCA
CCAGGACCTTGTGGTCCTCCTGGTCCACCTGGACCGCCCGGCCCACCAGGACCACCTGGACCAAATGGCC
CTCCAGGACCACCAGGGCCACCAGGACCCCCTGGTCCATTTGGTCCTCCAGGTCCATCAGGCAGAGAAGG
TCCATTTGGTCCGCCCGGCCCATCAGGTCCTCCTGGTCCACCAGGCCCACCAGGTCCTCCAGGACCCCCT
GGCCCACCAGGTCCACCTGGCCCCAAAGGTCCTAATGGTTCACCAACGTTATCTGGAATTTCGTTTTCTT
CCTCTGGTGTAGGTGTAGGCCCACCTGGTCCACCAGGGCCATTTGGTCCACCAGGCCCATTTGGGCCACC
TGGTCCATTTGGACCCCCTGGCCCATCTGGTCCTCCAGGCCCATTTGGTCCACCTGGCCCGCCAGGTCCA
CCTGGTCCTCCTGGCCCTCCCGGTCCTCCAGGTCCACCTGGTTTACCCACATCAGGGGGTGTGGTCTCAT
CTGTTGCAAGAGTTGGTCCTCCGGGTCCCCCTGGCCCCCCTGGACCTCCAGGTCCACCAGGTCCTCCAGG
TCCACCTGGACCTCCAGGACCACCAGGTTTTCCAGGTTTTCCTATGTCATCAGGGTTCACTGTAGGCCCA
CCAGGTCCATCAGTACTTGGCCCTCCTGGTCCATCTGGTCCACCTGGACCTCCTGGTCCCATAGGTCCAC
CTGGTCCCCCCGGTTCACCAGGCTCTGCCATTGCAGTTAGTTCAGGTCCACCTGGTCCTCCAGGACCACC
AGGACCAAATGGTCCTCCAGGACCACCTGGTCCAAATGGTCCACCTGGTCCATATATGCCACCAGGTCCA
CCAGTTTCACCGATATCATCAGGTAGAGTCACATCAGGAGCTAAAGATGGTCCATCAGGACCTCCTGGTC
CATCAGGTCCACCTGGTCCCCCTGGCCCTCCAGGGCCTCCAGGCCCTCCTGGCCCACCAGGCCCACCTGG
TCCCAGGGGTCCTAATGGTTCACCAACATTATCTGGAATTTCTAGTTCTTCTTCTGGTGTAGGAGTCGGT
CCACCTGGTCCTCCAGGGCCATTTGGTCCACCTGGTCCATTAGGACCTCCTGGTCCATTTGGTCCCCCTG
GTCCATTTGGTCCCCCGGGACCATCAGGTCCCCCTGGCCCACCTGGTCCCTGTGGTCCACCTGGTCCTCC
AGGTCCTCCAGGACCACCAGGTTTTCCTACACCAGGAGGTGTTGTCTCATCTGTAGCAAGGGTTGGTCCA
CCTGGCCCTCCTGGTCCCCCAGGCCCTCCTGGTCCACCAGGTCCACCAGGCCCTCCGGGTCCACCAGGAC
CAAGTGGTTTTCCAGGTTCACCAATGTCTTCTGGATTTACTTCAGGTCCACCAGGTCCATCAGGACCATT
AGGTCCACCAGAAGGTCCTCCAGGCCCATCTGGTCCACCTGGTCCTCCAGGACCACCAGGTCCCCCGGGA
CCACCTGGTCCCCCAGGACCATCAGGACCACCAGGTCCACCTGGTTCACCAATAGTTTCATCATCATCAG
GTTTGGGTGGCCCATCAGGCCCACCCGGCCCGCCAGGCCCACCTGGACCTCCAGGTCCACCTGGACCACC
AGGCCCGCCGGGACCACCAGGTCCCAGTGGTTCACCCACATCATCAGGAATAGTATCCTTCTCTTCTGCA
GTTGGTGTAGGTCCATCAGGTCCTCCTGGTCCCCCTGGTCCCCCTGGACCCCATGGCCCATTGGGACCCC
CAGGCCCATTTGGTCCACCAGGCCCATTAGGACCACCTGGGCCATTTGGCCCACCTGGCCCATTAGGTCC
TCCAGGTCCACCTGGGCCATTTGGTCCTCCTGGTCCATTTGGTCCTCCAGGCCCATTTGGTCCTCCCGGC
CCATCTTCTGTTCCAATGTCTGGTGCTACTGTTGCATCTGGTGATAATGTAGGTCCATCAGGACCACCTG
GGCCACCGGGTCCTCCAGGTCCACCTGGACCACCGGGACCTCCAGGCCCACCAGGTCCACCAGGCCCACC
AGGCCCTCCAGGACCTCCAGGTTCATTCAGTTTAGGTAAATACGATGGTATTTTTGCAAGTTCGTCAGGT
GATAATGTGGGTCCACCTGGTCCACCAGGCCCCTCTGAAATTAGAATACACGGTGTAATTGAGGCACTGA
TATTTACACTTACAACACTTTTATGTACATGA

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/96OsGWvioXJp1Q

Развернуть: https://yadi.sk/i/uIzs4Yo2465qdw

В этой структуре встречается два периода программной 255777-спирали и 3 периода 752-спирали. Интересно, как они выглядят в 3D ?

***

Заказ 2018-11-10_008: PPGPPGPPGPPGPPGPPGPPGPPGPPGPPG

https://www.ncbi.nlm.nih.gov/nuccore/XM … port=fasta

>XM_015814657.1 PREDICTED: Protobothrops mucrosquamatus collagen alpha-2(I) chain-like (LOC107286306), mRNA
ATGAGATCTGGGAAGCAAAATGCCAGATGTCCATCTCATGATTTATCCAACAAAATGAAGATTATGGTTG
TTCTTGCCTCTCTTTTTGCCCTCGTTGTTCCTTTAGAGGCCAGCAGTGAAAGTGGAAGCCATGAACGACG
GAGATACCGATATCCATATTATCGAGCTCCAAATTATGGCTATCGCAATCCAAATCCAAGGGGTGCTCCC
ATAATGTATGCTAGACTGGGGCCAGTGGGAGCTCCAGGGGCCAGAGGACCAGCAGGGCCTGCCAGGCCTG
TTGGGCCTGCAGGACGTGTAGGACCTGCTGGGCCTGACGGACCTGCCAGGCCTGCAGTGGCTGATTGGGC
CTCAGGTCCTCCGGGTCCTCCAGGTCCTCCAGGTCCTGAAGGTCCTCCAGGTCCTCCAGGTCCTCCAGGA
GGCCTAGGACCCCCAGGATACCCTGGTCCTCCAGGTCCTCCAGGTCCTCCAGGAGGCCTAGGAGGCCCAG
GAATCTCTGGTCCTCCAGGTCCTCCAGGACCTCCAGGTTCAAAAGGTCCCCCAGGTCCCCCAGGCCCCCG
AGGACCCCCAGGTCCCCCAGGACCCCCAGGACCCCCAGGACCCCCAGGACCAGACTATTTTCTAAAGTAT
TGCATATTCTGCCAATTAATATTATCAGAGATTATTGGAGATCTTTCTAATACAAAAGCGGAGCAAAAAC
TGCACTGCAAAGAAAAAGATTTATCCAACAAAATGAAGATTGTGGTTGTTCTTGCCTCTCTTTTTGCCCT
CGTTGTTCCTTTAGAGGCCAGCAGTGAAAGTGGAAGCCATGAACGACGGAGATACCGATATCCATATTAT
CGAGCTCCAAATTATGGCTATCGCAATCCAAATCCAATGGGTGCTCCCATGATGTATGCTAGACCGGGGC
CAGCGGGAGCTCCAGGGGCCAGAGGACTAGCAGGGCCTGCCGGGCCTGTTGGGCCTGCAGGACGTGCAGG
ACCTGCTGGGCCTGCCGGGCCTGCCGGGCCTGCCGGGCCTACTGGGCCTGCCGGGCCTGCTGGGGCCCCA
GGTGGCCCAGGTCCTCCAGGTCCTGCAGGTCCTCCAGGTCCTCCAGGTCCTCCAGGTCCTCCAGGAGGCC
CAGGAGGCCCAGGAGGCCCAGGACCCGCTGGTCCTCCAGGTCCTCCAGGACCTCCAGGTCCCCCAGGTCC
CCCAGGTCCCCCAGGACCCCCAGGACCCCCAGGACCCCCAGGGCCTCCCGGAGGCTAGACCTGTTCTGTT
GACTGGTAAGTCCTTCTGAGATACTTTACC

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/accodp5iFYb4cw

Развернуть: https://yadi.sk/i/g50SSngR9LH1gQ

В этом белке аминокислотная последовательность n(PPG) образует несколько разных программных спиралей.

***

Заказ 2018-11-10_009: PPGPPGPPGPPGPPGPPGPPGPPGPPGPPG

https://www.ncbi.nlm.nih.gov/Structure/ … ;uid=33675

Нуклеотидной последовательности найти не удаётся...

https://www.ncbi.nlm.nih.gov/nuccore/1743281

>CAA67871
atggcaagcgaaccgaacctaagatatccaattgaagaaacaggagatcgaggaccacca
ggacctccaggacctccaggaccacaaggacctccaggaccacaaggacctccaggacca
gcaggacctccaggaccaccaggacctccaggaccaccaggacctccaggaccaccagga
cctccaggacctccaggaccaccaggactgccaggattgtttgtaacaaatttattgctt
ggaatcatagttttactcttattaattatagtcgcgctcttactcgtgtctaaattagta
gtaaactaa

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/eS9JI3FQr2L69w

Развернуто:

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/3riwGs8LeYvP_Q
4.5 периодов программной 222227-спирали. Интересно увидеть 3D модель...

***
Заказ 2018-11-10_010: PPGPPGPPGPPGPPGPPGPPGPPGPPGPPG

https://www.ncbi.nlm.nih.gov/nuccore/EU … port=fasta

>EU834232.1 Synthetic construct triblock protein copolymer TR12T precursor (TR12T) gene, partial cds
CTCGAGAAAAGAGAGGCTGAAGCTGGTCCACCCGGTGCTCCCGGTCCGCCTGGTCCACCTGGTCCACCTG
GTCCACCAGGACCACCAGGTCCACCTGGACCACCGGGTCCTCCCGGACCAGCCGGTGAGTCCCCAGGTCC
TCAGCCTGGTGGTCCACAAAACCCAGGTTCAGGTGAAGGTCAGGGAAACGGTAACCCTAACAAGAATGGA
CCATCTCAAGGTGGTCAACCACAAGGAGGTGGTTCTCCAGGTTCCGGTGAACCACCAAACCCCAACCCTG
GCCCACAGAACGGTCAAAAGCCTGGTGGTCAACAAAACGGTCCTGGTAATGGTCAACAAGAGGGAAACGG
TCAACAAAACGGTGGTGGTTCTCAGTCCGGACCTGGATCTCCACCAGGAAAACCTCCAGGTCAGCCAGCC
GGTGAGTCCCCAGGTCCTCAGCCTGGTGGTCCACAAAACCCAGGTTCAGGTGAAGGTCAGGGAAACGGTA
ACCCTAACAAGAATGGACCATCTCAAGGTGGTCAACCACAAGGAGGTGGTTCTCCAGGTTCCGGTGAACC
ACCAAACCCCAACCCTGGCCCACAGAACGGTCAAAAGCCTGGTGGTCAACAAAACGGTCCTGGTAATGGT
CAACAAGAGGGAAACGGTCAACAAAACGGTGGTGGTTCTCAGTCCGGACCTGGATCTCCACCAGGAAAAC
CTCCAGGTCAGCCAGCCGGTGAGTCCCCAGGTCCTCAGCCTGGTGGTCCACAAAACCCAGGTTCAGGTGA
AGGTCAGGGAAACGGTAACCCTAACAAGAATGGACCATCTCAAGGTGGTCAACCACAAGGAGGTGGTTCT
CCAGGTTCCGGTGAACCACCAAACCCCAACCCTGGCCCACAGAACGGTCAAAAGCCTGGTGGTCAACAAA
ACGGTCCTGGTAATGGTCAACAAGAGGGAAACGGTCAACAAAACGGTGGTGGTTCTCAGTCCGGACCTGG
ATCTCCACCAGGAAAACCTCCAGGTCAGCCAGCCGGTGAGTCCCCAGGTCCTCAGCCTGGTGGTCCACAA
AACCCAGGTTCAGGTGAAGGTCAGGGAAACGGTAACCCTAACAAGAATGGACCATCTCAAGGTGGTCAAC
CACAAGGAGGTGGTTCTCCAGGTTCCGGTGAACCACCAAACCCCAACCCTGGCCCACAGAACGGTCAAAA
GCCTGGTGGTCAACAAAACGGTCCTGGTAATGGTCAACAAGAGGGAAACGGTCAACAAAACGGTGGTGGT
TCTCAGTCCGGACCTGGATCTCCACCAGGAAAACCTCCAGGTCAGCCAGCCGGTGAGTCCCCAGGTCCTC
AGCCTGGTGGTCCACAAAACCCAGGTTCAGGTGAAGGTCAGGGAAACGGTAACCCTAACAAGAATGGACC
ATCTCAAGGTGGTCAACCACAAGGAGGTGGTTCTCCAGGTTCCGGTGAACCACCAAACCCCAACCCTGGC
CCACAGAACGGTCAAAAGCCTGGTGGTCAACAAAACGGTCCTGGTAATGGTCAACAAGAGGGAAACGGTC
AACAAAACGGTGGTGGTTCTCAGTCCGGACCTGGATCTCCACCAGGAAAACCTCCAGGTCAGCCAGCCGG
TGAGTCCCCAGGTCCTCAGCCTGGTGGTCCACAAAACCCAGGTTCAGGTGAAGGTCAGGGAAACGGTAAC
CCTAACAAGAATGGACCATCTCAAGGTGGTCAACCACAAGGAGGTGGTTCTCCAGGTTCCGGTGAACCAC
CAAACCCCAACCCTGGCCCACAGAACGGTCAAAAGCCTGGTGGTCAACAAAACGGTCCTGGTAATGGTCA
ACAAGAGGGAAACGGTCAACAAAACGGTGGTGGTTCTCAGTCCGGACCTGGATCTCCACCAGGAAAACCT
CCAGGTCAGCCAGCCGGTGAGTCCCCAGGTCCTCAGCCTGGTGGTCCACAAAACCCAGGTTCAGGTGAAG
GTCAGGGAAACGGTAACCCTAACAAGAATGGACCATCTCAAGGTGGTCAACCACAAGGAGGTGGTTCTCC
AGGTTCCGGTGAACCACCAAACCCCAACCCTGGCCCACAGAACGGTCAAAAGCCTGGTGGTCAACAAAAC
GGTCCTGGTAATGGTCAACAAGAGGGAAACGGTCAACAAAACGGTGGTGGTTCTCAGTCCGGACCTGGAT
CTCCACCAGGAAAACCTCCAGGTCAGCCAGCCGGTGAGTCCCCAGGTCCTCAGCCTGGTGGTCCACAAAA
CCCAGGTTCAGGTGAAGGTCAGGGAAACGGTAACCCTAACAAGAATGGACCATCTCAAGGTGGTCAACCA
CAAGGAGGTGGTTCTCCAGGTTCCGGTGAACCACCAAACCCCAACCCTGGCCCACAGAACGGTCAAAAGC
CTGGTGGTCAACAAAACGGTCCTGGTAATGGTCAACAAGAGGGAAACGGTCAACAAAACGGTGGTGGTTC
TCAGTCCGGACCTGGATCTCCACCAGGAAAACCTCCAGGTCAGCCAGCCGGTGAGTCCCCAGGTCCTCAG
CCTGGTGGTCCACAAAACCCAGGTTCAGGTGAAGGTCAGGGAAACGGTAACCCTAACAAGAATGGACCAT
CTCAAGGTGGTCAACCACAAGGAGGTGGTTCTCCAGGTTCCGGTGAACCACCAAACCCCAACCCTGGCCC
ACAGAACGGTCAAAAGCCTGGTGGTCAACAAAACGGTCCTGGTAATGGTCAACAAGAGGGAAACGGTCAA
CAAAACGGTGGTGGTTCTCAGTCCGGACCTGGATCTCCACCAGGAAAACCTCCAGGTCAGCCAGCCGGTG
AGTCCCCAGGTCCTCAGCCTGGTGGTCCACAAAACCCAGGTTCAGGTGAAGGTCAGGGAAACGGTAACCC
TAACAAGAATGGACCATCTCAAGGTGGTCAACCACAAGGAGGTGGTTCTCCAGGTTCCGGTGAACCACCA
AACCCCAACCCTGGCCCACAGAACGGTCAAAAGCCTGGTGGTCAACAAAACGGTCCTGGTAATGGTCAAC
AAGAGGGAAACGGTCAACAAAACGGTGGTGGTTCTCAGTCCGGACCTGGATCTCCACCAGGAAAACCTCC
AGGTCAGCCAGCCGGTGAGTCCCCAGGTCCTCAGCCTGGTGGTCCACAAAACCCAGGTTCAGGTGAAGGT
CAGGGAAACGGTAACCCTAACAAGAATGGACCATCTCAAGGTGGTCAACCACAAGGAGGTGGTTCTCCAG
GTTCCGGTGAACCACCAAACCCCAACCCTGGCCCACAGAACGGTCAAAAGCCTGGTGGTCAACAAAACGG
TCCTGGTAATGGTCAACAAGAGGGAAACGGTCAACAAAACGGTGGTGGTTCTCAGTCCGGACCTGGATCT
CCACCAGGAAAACCTCCAGGTCAGCCAGCCGGTGAGTCCCCAGGTCCTCAGCCTGGTGGTCCACAAAACC
CAGGTTCAGGTGAAGGTCAGGGAAACGGTAACCCTAACAAGAATGGACCATCTCAAGGTGGTCAACCACA
AGGAGGTGGTTCTCCAGGTTCCGGTGAACCACCAAACCCCAACCCTGGCCCACAGAACGGTCAAAAGCCT
GGTGGTCAACAAAACGGTCCTGGTAATGGTCAACAAGAGGGAAACGGTCAACAAAACGGTGGTGGTTCTC
AGTCCGGACCTGGATCTCCACCAGGAAAACCTCCAGGTCAGCCAGCCGGTGCTCCCGGTCCGCCTGGTCC
ACCTGGTCCACCTGGTCCACCAGGACCACCAGGTCCACCTGGACCACCGGGTCCTCCCGGACCAGCCGGT
GGCTAATAGAATTC

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/fn_PkLIyskcRig

Развернуть: https://yadi.sk/i/SRoEx7cx_v7P-g

Слушать музыку (MIDI): https://yadi.sk/d/EN4zaRAAJboQeg

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/eAg3dGYl5S6b2A

Неплохое начало (8 нот), не правда ли?

В минорном варианте я эти 8 нот точно слышал. Кстати в нотах сборки этого белка эта фраза проходит несколько раз с вариациями...

Структура белка представляет собой программную спираль с периодом 99 аминокислотных остатков!
А строится она в 99-дольном размере smile

Как вам музыкальный размер 99/8 ?

27

Re: Музыка сборки белка в профессиональной аранжировке

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-14_002: GKSQIGKSQIGKSQIGKSQIGKSQIGKSQIGKSQIGKSQIGKSQIGKSQI

https://www.ncbi.nlm.nih.gov/protein/XP … PPXXDB9014

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/gaeg99Td_-0iZQ
Развернуть: https://yadi.sk/i/Rtou7JK6OjD9PA
Слушать(MIDI): https://yadi.sk/d/oSr9ix-H3eP2jw

Программная 27575557-спираль переходит в 2775572257-спираль, затем в 2111111-спираль и, наконец, в 21141-спираль. Это один из самых экзотических белков, которые мне попадались...

Интереснее всего звучит сборка самой длинной программной 2775572257-спирали в 10-дольном музыкальном размере. Над будет сделать аранжировку...

28

Re: Музыка сборки белка в профессиональной аранжировке

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-14_011: GKSQIGKSQIGKSQIGKSQIGKSQIGKSQIGKSQIGKSQIGKSQIGKSQI

>PGOL01007770.1:c3269-1 Punica granatum strain AG2017 PG007770, whole genome shotgun sequence
atccaaggatgggactcggcctggggaagatctaacgatgggattcggcccaacgaaaga
tcaaaggttgggactcggcccagggggagatctaacgatgggactcagccctacggaaga
tcaaaggttgggactcgtccctgggggagatctaacgatgcgactcggccctacgaaagt
tcaaaggatgggactcggccctgggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactcggccctgtgggagatctaacgatgcgactcggccctacggaaga
tcaaaggttgggactccgcccagggggagatctaacggtgggactcggccctacggaaga
tcaaaggttgggactcggctctgggggagatctaacgatgagactcggccctacgaaaga
tcaaaggatgggactcggcccagggggagatctaa

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/nDFBwgyC-6zzOA
Развернуть: https://yadi.sk/i/K9jwT9lakQ0zAA
Слушать(MIDI): https://yadi.sk/d/UIhJRsRH669gyw

Программная спираль строится в 40-дольном музыкальном размере.

Структуры белков такого типа могут наглядно продемонстрировать триумф пикотехнологии белков.

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/X2zaTRlKbAPevw

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/AqNvNU1_DMpjKg

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/02o8pb1oj0DUCg

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/YWhzsoqRaw5E3w

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/5cDhg4KlmVkmRQ

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/RbV-Te2qx0hyPw
Полновесная анимация (avi, 63Mb): https://yadi.sk/i/cdixlJKwoI9Eyw

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/tRyTwNarkCi-CA
Полновесная анимация (avi, 27Mb): https://yadi.sk/i/g9qzgoDeH12mMA

Обратите внимание на пары радикалов лизина (Lys):

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/zzGCvdTc9UUHHA

Напомню, как выглядит пикотехнологическая модель ДНК:

http://nanoworld88.narod.ru/data/237_files/0_4e1a8_e8302c5f_M.gif

29

Re: Музыка сборки белка в профессиональной аранжировке

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_004: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://www.ncbi.nlm.nih.gov/nuccore/PG … nd-gaps=on

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/Mz6T1d2VoligAA
Развернуть: https://yadi.sk/i/bYyef3FC-vhIcw
Слушать(MIDI): https://yadi.sk/d/ks6qwoYGIihtfA

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_005: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://www.ncbi.nlm.nih.gov/protein/PK … TFVRRBH014

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/yF4whemjrPY5Qw

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/lBJ8kZiyPjYNbQ

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/6HUSYZ3OIdjQow

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/8oTVlq-8dwdJzg

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/YTEU2VFuJYi1LA

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/BpRIO3HupXLu0A

Кушелев: Punica granatum - даже не золотое, а бриллиантовое дно!

В одном геномном файле 6 "монстров белкового мира" подряд!

Нужно будет делать их 3D модели и настраивать по ним интерактивную версию Пикотех 3D. Скорее всего все эти белки работают с ДНК/РНК, а значит должны быть согласованы с ними по многим параметрам.