901

Re: Online service PROTEIN PICOTECHNOLOGY

Online service PROTEIN PICOTECHNOLOGY

http://www.nanoworld.org.ru/data/01/dat … 910807.htm

Цитата: ...висели, стояли, лежали модели атомов и элементарных частиц по Кушелеву, и под каждой был ценник. Здесь почти все продавалось. Модель атома палладия – тридцать рублей. Модель квазикристалла (на снимке вверху) – шестьдесят. Конечно, их никто не покупал. Надо уж совсем ума лишиться, чтобы заплатить шестьдесят рублей за два десятка пластмассовых колец и трубок, скрепленных нитками.

http://www.nanoworld.org.ru/data/01/data/images/pictures/sasha_wn.jpg

Никто ведь не понимает, что Кушелев продает.
Конец цитаты.

Подробнее: http://www.nanoworld.org.ru/data/01/dat … 910807.htm

Кушелев: С 1992 года прошло 2018-1992=26 лет, но те, кто хочет утысячерить свои финансы так и не поняли, что они могут это сделать, например, с помощью внедрения уже готовой пикотехнологии белков...

902

Re: Online service PROTEIN PICOTECHNOLOGY

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_017: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://www.ncbi.nlm.nih.gov/protein/PK … TFVRRBH014

https://www.ncbi.nlm.nih.gov/nuccore/PG … nd-gaps=on

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/4OxtJlt1Oklc5w

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/sZNHtoyl5QMZ2A

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/PordpxEmb2UrGQ

903

Re: Online service PROTEIN PICOTECHNOLOGY

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_018: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://www.ncbi.nlm.nih.gov/protein/PK … TFVRRBH014

https://www.ncbi.nlm.nih.gov/nuccore/PG … nd-gaps=on

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/t7eaiGzfLNnPSQ

59 аминокислотных остатков в периоде

904

Re: Online service PROTEIN PICOTECHNOLOGY

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_019: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://www.ncbi.nlm.nih.gov/protein/PK … TFVRRBH014

https://www.ncbi.nlm.nih.gov/protein/AA … TFVRRBH014

https://www.ncbi.nlm.nih.gov/nuccore/156605

https://www.ncbi.nlm.nih.gov/nuccore/1305252709

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/MUS1WArwpbCt1w

905

Re: Online service PROTEIN PICOTECHNOLOGY

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_020: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://www.ncbi.nlm.nih.gov/protein/PK … V17FJWT015

https://www.ncbi.nlm.nih.gov/nuccore/PG … nd-gaps=on

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/osk0vmojSExSvA

906

Re: Online service PROTEIN PICOTECHNOLOGY

Кушелев: Это было только начало лавины научных открытий в области молекулярной биологии...

DNE-файл: https://yadi.sk/d/atSs38mqHRB2xQ

PDB-файл: https://yadi.sk/d/4VE_IEBkXehBZQ

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/dokMJQcwaL3NFQ
Вид вдоль оси симметрии программной спирали максимального радиуса. Спираль имеет ось симметрии ~5-го порядка.

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/0lQuGk44cRkAsw
То же. Вид сбоку

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/yU2dbGyl82qekg
Общий вид модели белка

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/DVrZ772d_7IfTw
Вид вдоль оси симметрии другого участка программной спирали. Ось симметрии ~9-го порядка.

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/LowqRqckIJRazg
То же. Вид сбоку

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/CSg5lg-XArM2zg

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/XhcCjhWlv6HizQ

Кушелев: В структуре этого белка мы видим один участок программной спирали, имеющий форму ДНК, т.е. именно этот участок, вероятно, скользит вдоль спирали ДНК. Другие участки имеют форму, ассоциирующуюся с цилиндрическими цистернами / контейнерами / реакторами.

Точные модели подобных пико-агрегатов мы сможем увидеть после создания интерактивной версии программы Пикотех 3D, где можно будет настраивать не только композиционные, но и транспозиционные углы (индивидуально для каждого аминокислотного остатка), уточнить углы метионина и индивидуально подобрать углы пролина.

907

Re: Online service PROTEIN PICOTECHNOLOGY

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_022:

DNE-файл: https://yadi.sk/d/FEZIoW494k4_Hw

PDB-файл: https://yadi.sk/d/cAL3Sn8Y7gan0w

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/2d6p3cPiteqjrg

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/5bhc6w1JJFRAhg

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/70u4Tastbz0tvg

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/0dFxXrlmCq78AA

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/0dFxXrlmCq78AA

908

Re: Online service PROTEIN PICOTECHNOLOGY

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_023:

DNE-файл: https://yadi.sk/d/EIgF7gUwO-EqrA

PDB-файл: https://yadi.sk/d/dAJA5Hqav8DwuQ

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/JGfNah-KeK8-rg

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/eQR3qSqex8JHsQ

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/UwgAHAczV1_08w

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/P6JJA0oE620b5w

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/aLVTlswEBJgVFA

909

Re: Online service PROTEIN PICOTECHNOLOGY

Формы, механизмы, энергия наномира. Сообщение 103 088

Ludmila пишет:

Kushelev:
Продолжаем обриллианчивать человечество новыми научными открытиями.
Это было только начало лавины научных открытий в области молекулярной биологии.

Лавин открытий не бывает, это единичные уникальные явления.
Научное открытие – это раскрытие и научное обоснование существующих закономерностей,
сил и связей между явлениями, до этого неизвестных человечеству.
Научное открытие далеко не всегда обладает элементом, необходимым для изобретения,
а именно – промышленной осуществимостью.
https://soviet_legal.academic.ru/1042/НАУЧНОЕ_ОТКРЫТИЕ
В России авторство на научное открытие законом не охраняется :
https://ru.wikipedia.org/wiki/Открытие

«… если упреждение (востребованности открытия) слишком большое, открытие летит мимо цели.»
— Даниил Гранин, "Зубр", стр.44

Кушелев: Я правильно понял, что по теме "Уилтширский Наутилус" Вы полностью сдали позиции, т.е. более не пытаетесь искать ни чертежи, ни другие данные, на основе которых люди могли бы пытаться изобразить этот Crop Circle хотя бы на бумаге.

Что касается моих научных открытий, то я фактически создал индустрию научных открытий, поэтому мне удаётся их делать почти ежедневно. Для кого-то это "случай скорее единичный, чем редкий", а для меня - обычное дело smile

Что касается востребованности, то не нужно быть 7 пядей во лбу, чтобы не заметить, что сегодня ежедневно кто-то оплачивает 50-100 структур белков, сделанных по старой технологии. В среднем по 10 000 евро за штуку, т.е. тратит 0.5 - 1 миллион евро в день.

С помощью новой технологии, которую я создал совместно с коллегами, за один день можно определить тысячи структур белков, причём на уровне вторичной структуры значительно точнее и надежнее РСА. Мне нетрудно повторить, что РСА не может отличить пи-спираль от альфа-спирали и комбинации пи-альфа-кодов. Не может отличить программную спираль коллагена от тройной спирали.

Вчера мне удалось построить в автоматическом режиме модель программной спирали белка, которая имеет те же пространственные параметры, что и ДНК. Случайностью это быть не может.

А это значит, что исследователи белков могут получить надёжные данные об исследуемых белков с помощью программы Пикотех 2D и 3D.

То, что никто из специалистов, кроме Виктории Соколик, не пользуется возможностями программы Пикотех, говорит о научной слепоте подавляющего большинства молекулярных биологов. Или они просто не знают о существовании пикотехнологии белков уже на уровне онлайн-сервиса: http://nanoworld.org.ru/topic/1699/page/89/

Это меня не удивляет, т.к. обычно специалисты в т.ч. по структурам белков, кроме себя и тех, кто их непосредственно окружает в помещении, ничего не замечают. А если читают новости, то в специализированных журналах, где про настоящие научные открытия уже давно не пишут. Там пишут о работах "настоящих ученых", а не о настоящих открытиях...

Обычно фундаментальные открытия "научный мир" замечает не с первого раза, а после второго-третьего независимого открытия, которое случается через 20 ... 50, а иногда и 100 лет. Такая слепота и тормозливость "научного мира" и является главным тормозом научного прогресса. До последнего будут выбрасывать деньги на старые технологии, пока не придёт приказ сверху бросать это бесперспективное занятие.

И весь вопрос, как добраться до тех, кто сможет понять, что пора снимать  академические ноги с тормозных педалей молекулярной биологии и сможет дать эту команду. Ну или как обычно ждать, пока старое поколение по Максу Планку вымрет, а новое, выученное на новых учебных пособиях: http://nanoworld88.narod.ru/data/250.htm

станет пользоваться новой технологией.

А нанотех против пикотех, что сабля против пулемёта: http://nanoworld88.narod.ru/data/284.htm

Мне интересно найти нестандартное решение, чтобы наша цивилизация не тормозила лишнее поколение, а воспользовалось новой технологией (пикотехнологией белков) не через 50 лет (27 уже прошло), не через 100, а хотя бы через 30 лет после моего научного открытия.

Надежды, конечно, мало, но ... придумаем что-нибудь нестандартное...

Структуры всех белков человека уже определены: http://nanoworld.org.ru/topic/1699/

Теперь надо показать пикотехнологические модели комплексов ДНК + белок, где видна пикотехнологическая точность. Правда, для этого придётся создать интерактивную версию программы Пикотех 3D, а чтобы её быстрее настроить, нужно распечатать на 3D принтере элементы пикотехнологического конструктора: http://nanoworld.org.ru/topic/2007/page/8/

У инвесторов лаборатории Наномир сейчас напряженка с деньгами, а новые, пока что потенциальные инвесторы ещё "не проснулись". Надо их как-то разбудить и объяснить, что пикотехнология - это их "золотые горы", которые никак не могут их дождаться уже на протяжении 27 лет...

http://img-fotki.yandex.ru/get/5905/nanoworld2003.23/0_4a672_1493e464_orig.jpg
http://img-fotki.yandex.ru/get/5905/nan … 4_orig.jpg

910

Re: Online service PROTEIN PICOTECHNOLOGY

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_024:

GBK-файл: https://yadi.sk/d/Q1WcKSPjmJzJ3A

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/b5TuBwtuKPHXkA

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/XCYz0wAZ_KrAWQ

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/fPuEjdhs7yq_KA

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/hNZqaZcTHV4kjA

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/JYTEyImnw5i_OA

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/lZ1SZgqwoRrjeA

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/MF6m6xZq2eVxkg

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/7nC-1PPNZ45ouw

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/zmLlWbQUSjrnqQ