891

Re: Online service PROTEIN PICOTECHNOLOGY

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_007: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://www.ncbi.nlm.nih.gov/protein/PK … TFVRRBH014

https://www.ncbi.nlm.nih.gov/nuccore/PG … nd-gaps=on

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/nfmTWpEA3Dy3Aw

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/GQWGN27mYt_2uA

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/ZOGbm_M9Gjv5mQ

Кушелев: Информация к размышлению для тех, кто хочет обриллиантить человечество и, в том числе, себя smile

892

Re: Online service PROTEIN PICOTECHNOLOGY

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_008: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://www.ncbi.nlm.nih.gov/nuccore/PG … nd-gaps=on

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/d32uiBmHe2dWZQ

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/PjGD_21sqMfgDA

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/GPSyk7lxKYUZ1A

Кушелев: Обриллиантим человечество вместе?

893

Re: Online service PROTEIN PICOTECHNOLOGY

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_009: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://www.ncbi.nlm.nih.gov/protein/PK … TFVRRBH014

https://www.ncbi.nlm.nih.gov/nuccore/PG … nd-gaps=on

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/ZumDr9x7xJfhBw

894

Re: Online service PROTEIN PICOTECHNOLOGY

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_010: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://www.ncbi.nlm.nih.gov/protein/PK … TFVRRBH014

https://www.ncbi.nlm.nih.gov/nuccore/PG … nd-gaps=on

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/-2Dy7_cdGEe4OA

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/djE6Jk88NgtxpA
Период программной спирали составляет 76 аминокислотных остатков

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/lb3tm6ThpHTIbA
Период программной спирали составляет 76 аминокислотных остатков

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/y2BbepoM4TXJ2w

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/ydo4_qMYJBHvhw

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/2dXnlLjc-neKFw

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/zbEo5ge250EVkg

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/oq8ygnJNLsCk0w

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/8ThGrBEG5qSsaQ

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/q9ZUHXQJK4XJ2w

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/iTOJFBuqHhDuHg

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/7ybN8rd05y7FOA

895

Re: Online service PROTEIN PICOTECHNOLOGY

Формы, механизмы, энергия наномира. Сообщение 103 074

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_011: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://www.ncbi.nlm.nih.gov/protein/PK … TFVRRBH014

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/O-I9n_KbYDhfrw

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/iLzM0IxR_6zcwA

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/Gs_dyeRwt8ZLuA

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/B5JIO6bIsx45aA

896

Re: Online service PROTEIN PICOTECHNOLOGY

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_012: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://www.ncbi.nlm.nih.gov/protein/PK … TFVRRBH014

https://www.ncbi.nlm.nih.gov/nuccore/1305216915

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/kFbXCz6IBfcAzg

897

Re: Online service PROTEIN PICOTECHNOLOGY

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_013: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/0KMmLPd_uyDDEg

898

Re: Online service PROTEIN PICOTECHNOLOGY

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_014: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://www.ncbi.nlm.nih.gov/protein/PK … TFVRRBH014

https://www.ncbi.nlm.nih.gov/nuccore/PG … nd-gaps=on

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/8Ld3pIWOYQ9eBw

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/FMsQdKD-qGRpnw

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/YTDsdQgUqoFD-A

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/Dl2lBcGoef41oA

899

Re: Online service PROTEIN PICOTECHNOLOGY

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_015: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://www.ncbi.nlm.nih.gov/protein/PK … TFVRRBH014

https://www.ncbi.nlm.nih.gov/nuccore/PG … nd-gaps=on

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/ReIkVRrgcnwBpw

900

Re: Online service PROTEIN PICOTECHNOLOGY

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_016: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/gpUHx5gOpsiTMw

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/3vOQ5bubPc-m5A