881

Re: Online service PROTEIN PICOTECHNOLOGY

Формы, механизмы, энергия наномира. Сообщение 103 056

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-14_008: GKSQIGKSQIGKSQIGKSQIGKSQIGKSQIGKSQIGKSQIGKSQIGKSQI

>AYPS01005575.1 Helicosporidium sp. ATCC 50920 contig-5575, whole genome shotgun sequence
gcaaggatgaggttggcaaggatgaggctggcaaggatgaggttggcaaggatgaggctg
gcaaggatgaggttggcaaggatgaggctggcaaggttttgccagcctcatcttga

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/frTM7kuagf7UHA

Развернуто:

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/OAhGRtAv3KAytw
Слушать(MIDI): https://yadi.sk/d/FyKoVWYuDSg3Vw

1611216142-спираль

882

Re: Online service PROTEIN PICOTECHNOLOGY

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-14_009: GKSQIGKSQIGKSQIGKSQIGKSQIGKSQIGKSQIGKSQIGKSQIGKSQI

>XM_020698601.1 PREDICTED: Sesamum indicum kinesin-like protein KIN-14P (LOC105176049), mRNA
atggatcgagaaggaaaagattgtgctagattcaataactcgagcttttccagcaatagt
gatatatttgaacccccttcaagtaacaatgctaagcagcgggcaactttgatagaatgg
ttaaatagcactcttgatctaagtttgccaataaatgcttcagatgaagaattgcgagca
ttcttggttgatggatctatcttgtgtcaaatactaaacaaactaaaacccggttcggta
actgagtgtggtggatcagttcatactccaaaatcacggttgggaaatgtccaaagattt
ttgtcagcaatggatgaaatggggttgccaaggtttcaggcagcagacctggaaaagggg
tctatgaaaattgtcttggactgccttttaacactacaaacacagttcatgaatattggg
aggtctaggagtgatcccagttcaagatggaaattattaggtgagcgcccagtaactggg
gatactcttccaagggaagaatcccctcgatttctctcttccccaccatttggagaagac
aagaagaagttagtaatagactcaaagtttcagcgtgcattgcgtagtcgcacaatgaca
gattcatcagctgcccttataaatcatgtgggtcataagtttcatgaggtcttccaactt
aaacaaggatcttatacggatcttcctgctgcaaagatttcagaaatgatgaaatcaaac
agcttagataatgctccgactcagtcactattaagtgttgtcaatggtattttagatgaa
agcattgagcggaagagtggagcaatacctcatcgtgttgcttgcctattgagaaaagtt
gtgcaggagattgagagacggatatgtactcaagcagaacatttgcgaacgcaaaataat
ctttttaaggcacgtgaggaaaagtaccaatcaagaattagagtgcttgaagcccttgca
acagggactagcgaagagacacagattgttatgaaccaactccaacagcttaagagtgag
aagaacaaaatagaagaaagaaagagagtggaggaacaagatgtgttaagactaataaaa
gagaaagatgacctcaatcaagagatagcaaatttgatgcaagagctggaaatagctagg
agttcgtatgaacaagaatcctcgaaaatgaaacatgaaactggaggagttgaagctaca
ggagctgaagttggaggaactaaagttgaaggagctgaagctggaagagctgaagctgga
ggagctgaagttggaagagctgaagctggaggagctgaagttggaagagcagaagctgga
ggagctgaagttggaaaagcagaagctggaggagctgaagttggaagagcagaagctgga
ggagctgaagttggaagagcagaagctggaggagctgaagttggaagagcagaagcaaga
gcagaagctggaggagctgaagttggaggagctgaagttagaagagctgaagctggagga
gctaaagttggaagagcagaagctggaggagctgaagttggaagagctgaagctggagga
gctgaaattggaagagctgaaggaagaatagctgaagtcggaatagctgaagctggagga
gctgaagatggaagagctgaagctggaagagctgaatttagaactgctgaagctggaaga
gctgaacaagaacttgagaataggttgaaggaagttgaaggctcgctaatggagtcaaga
aatagagtgaatgaagttgaaggattgctaatggagtcaagaaatagagtaaaggaagtt
gaaagtgcgctaatggagtcaagaaatagagtaaaggaagttgaaagtgcgttaatggag
tcaagaaatagagtgaatgaatttgaaagcgcgctaacggagtcaagaaatagagtcaag
gaagttgaaagtgcgctaatggagtcaagaaatggagtgaatgaatttgaaagtgcgcta
acggagtcaagaaatagagtgaaggaatttgaaagctcactaatggaatcaagaaataga
gtgaacgaagttgaaagcgctctatcggagtcaagaaataaagtgaaggaagttgaaagc
ttgctaatggagtcaagaaacagagagaaggagcttgaggcaatctcagaatcaaaatct
gaaagctggagcaagaaagaaaacatttaccacatattcacagattttcagcttggcgca
ttacgtgaactaaggttcgcatctcagtctatccagcaagaaattgtgaggacaaagaaa
agctattcagaaggcttcagtactttagggtcaagaatcaaggtcctagacgatgcagcc
aaaaactattattcactccttgctgaaaatcgaaagttacataatgaactacaagagtta
aaaggaaatattagggtctattgtcggatacggccatttcttccaggccaaaaagggaaa
caatcaattgttgaatacattggtgaaaatggagagctaatagttgtgaatccggccaaa
caagggaaagaaggacgtcgttcgtttaagttcgataaagtgtatggtccaacagcaaca
caagctgaagtattttcagatacacaaccattaatacaatcagttttggatgggtataat
gtgtgtatatttgcctacggtcagactggttcaggcaaaacctatacaatgactggccct
gacggagcaactgaagaggactggggggtcaactacagagctttaaacaatcttttccgc
atttcacaaagtcgacagagcagttttacatatgaagtttccgtccagatggtcgaaata
tataatgaacaagttcgtgatttgctgtcaagtgatggtacacagaaaaaaacacttggg
atttctaccgcgaaacccaatggcttggcagtcccagatgcttccgttcaagcagttaac
tcaacctcagatgtcttggaactaatggatattggactaaagaatagagctaaaagctct
actgccttaaatgaaagaagtagtagatcacacagtgttgtctccattcatgcccgtggt
gtggatctaaagagtggttcttcattgcgagggagtcttcatttagtagatcttgcagga
agtgaaagagtagaccgttcagaggtaacaggagacagacttaaagaggcacaacatata
aataaatcattatctgcacttggagatgttatatttgctttatcacaaaagaatgctcat
gttccgtaccggaacagcaagttgactcaagtcctccagagctcgttaggtggtcaggca
aagacacttatgtttgtgcagcttaatcctgatgttagttcctatagtgaaaccttaagt
actttaaaatttgctgaaagggtctccggagttgagttgggtgcagcaaaaagcagcaag
gacggtagggacgtaagggagttgatggagcaggttgcgtctctgaaagaggctatagcg
aagaaagacgacgagatagagacgctgcagctgcataaagatcccaaaactgcggtataa

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/ul3MNKlLxLS2Cg
Развернуть: https://yadi.sk/i/2FCEQ9u0vuqYxA
Слушать(MIDI): https://yadi.sk/d/QA8L6AJ45PB5AA

Спираль 22777 с вариациями (эволюционирующая)

883

Re: Online service PROTEIN PICOTECHNOLOGY

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-14_010: GKSQIGKSQIGKSQIGKSQIGKSQIGKSQIGKSQIGKSQIGKSQIGKSQI

>NC_027707.1:c173910-173662 Salmon gill poxvirus, complete genome
ATGACACCCGTTACAAATAGTAAAAGTAGTAGCATTGACATGTTGTCACTTTTTTTTACAATATGTAAAG
GAATGTGTCCGATACCTGTCAGGTATTTTTATTTCATTTCTGGTAAAAGTCAATCTGGTAAAAGTCAATC
TGGTAAAAGTCAATCTGGTAAAAGTCAATCTGGTAAAAGTCAATCTGGTAAAAAGGTTCATGTGGGAAAC
TTACACTTGGGAAACTTACACTGTAATAAAAAAATATAG

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/TETWLGlPO_4wcQ

Развернуто:

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/UKCF1NgnIZFkrw
Слушать(MIDI): https://yadi.sk/d/jsmQtVv8Ov77SA

884

Re: Online service PROTEIN PICOTECHNOLOGY

Формы, механизмы, энергия наномира. Сообщение 103 060

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-14_011: GKSQIGKSQIGKSQIGKSQIGKSQIGKSQIGKSQIGKSQIGKSQIGKSQI

>PGOL01007770.1:c3269-1 Punica granatum strain AG2017 PG007770, whole genome shotgun sequence
atccaaggatgggactcggcctggggaagatctaacgatgggattcggcccaacgaaaga
tcaaaggttgggactcggcccagggggagatctaacgatgggactcagccctacggaaga
tcaaaggttgggactcgtccctgggggagatctaacgatgcgactcggccctacgaaagt
tcaaaggatgggactcggccctgggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactcggccctgtgggagatctaacgatgcgactcggccctacggaaga
tcaaaggttgggactccgcccagggggagatctaacggtgggactcggccctacggaaga
tcaaaggttgggactcggctctgggggagatctaacgatgagactcggccctacgaaaga
tcaaaggatgggactcggcccagggggagatctaa

DNE файл: https://yadi.sk/d/hTZpqPhd_l78XQ

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/nDFBwgyC-6zzOA
Развернуть: https://yadi.sk/i/K9jwT9lakQ0zAA
Слушать(MIDI): https://yadi.sk/d/UIhJRsRH669gyw

Программная спираль строится в 40-дольном музыкальном размере.

Структуры белков такого типа могут наглядно продемонстрировать триумф пикотехнологии белков.

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/X2zaTRlKbAPevw

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/AqNvNU1_DMpjKg

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/02o8pb1oj0DUCg

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/YWhzsoqRaw5E3w

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/5cDhg4KlmVkmRQ

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/RbV-Te2qx0hyPw
Полновесная анимация (avi, 63Mb): https://yadi.sk/i/cdixlJKwoI9Eyw

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/tRyTwNarkCi-CA
Полновесная анимация (avi, 27Mb): https://yadi.sk/i/g9qzgoDeH12mMA

PDB: https://yadi.sk/d/rFWdCW65J-5ODQ

Обратите внимание на пары радикалов лизина (Lys):

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/zzGCvdTc9UUHHA

Напомню, как выглядит пикотехнологическая модель ДНК:

http://nanoworld88.narod.ru/data/237_files/0_4e1a8_e8302c5f_M.gif

885

Re: Online service PROTEIN PICOTECHNOLOGY

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_001: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://www.ncbi.nlm.nih.gov/protein/PK … TFVRRBH014

https://www.ncbi.nlm.nih.gov/nuccore/1305246555

https://www.ncbi.nlm.nih.gov/nuccore/PG … nd-gaps=on

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/RxKnNiwLVR-OUA

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/voS-Lo0tUv8Hew

Развернуть: https://yadi.sk/i/aIQaV0_t1jkFoA
Слушать(MIDI): https://yadi.sk/d/x5tpGbGLrtOGog

886

Re: Online service PROTEIN PICOTECHNOLOGY

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_002: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/MLb9BMT3Umx7mg
Развернуть: https://yadi.sk/i/ySvxUHeNr34nbA
Слушать(MIDI): https://yadi.sk/d/Szpe04qVueMYbg

887

Re: Online service PROTEIN PICOTECHNOLOGY

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_003: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/GVm5luR4f55v7g
Развернуть: https://yadi.sk/i/TsOOSpHVSR7xNw
Слушать(MIDI): https://yadi.sk/d/_Ifbzgo9J0VmWw

888

Re: Online service PROTEIN PICOTECHNOLOGY

Формы, механизмы, энергия наномира. Сообщение 103 062

Сравниваем пропорции белка и ДНК

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/AqNvNU1_DMpjKg
Подробнее: http://nanoworld.org.ru/post/110347/#p110347

http://nanoworld88.narod.ru/data/248_files/0_5197a_14ad55f9_L.png
Подробнее: http://nanoworld88.narod.ru/data/248.htm

889

Re: Online service PROTEIN PICOTECHNOLOGY

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_004: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://www.ncbi.nlm.nih.gov/nuccore/PG … nd-gaps=on

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/Mz6T1d2VoligAA
Развернуть: https://yadi.sk/i/bYyef3FC-vhIcw
Слушать(MIDI): https://yadi.sk/d/ks6qwoYGIihtfA

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_005: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://www.ncbi.nlm.nih.gov/protein/PK … TFVRRBH014

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/yF4whemjrPY5Qw

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/lBJ8kZiyPjYNbQ

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/6HUSYZ3OIdjQow

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/8oTVlq-8dwdJzg

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/YTEU2VFuJYi1LA

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/BpRIO3HupXLu0A

Кушелев: Punica granatum - даже не золотое, а бриллиантовое дно!

В одном геномном файле 6 "монстров белкового мира" подряд!

Нужно будет делать их 3D модели и настраивать по ним интерактивную версию Пикотех 3D. Скорее всего все эти белки работают с ДНК/РНК, а значит должны быть согласованы с ними по многим параметрам.

890

Re: Online service PROTEIN PICOTECHNOLOGY

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_006: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://www.ncbi.nlm.nih.gov/protein/PK … TFVRRBH014

https://www.ncbi.nlm.nih.gov/nuccore/PG … nd-gaps=on

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/-YrG7YUWIhjy3A

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/d61Ll4lQLlIvvA
Продолжаем обриллианчивать человечество новыми научными открытиями...