431

Re: Формы, механизмы, энергия наномира - 84

Формы, механизмы, энергия наномира. Сообщение 84 431

Пикотехнология белков, ДНК, РНК - 2

Уважаемая Виктория!

Я правильно понял, что белок с последовательностью -Trp-Met-Trp-Met-

https://www.ncbi.nlm.nih.gov/bioproject/PRJNA168

ещё готовится к определению структуры? Если так, то может быть пошлём специалистам его вторичную структуру по программе Пикотех, чтобы они убедились, что мы заранее знаем структуру белка, который они только планируют исследовать?

https://img-fotki.yandex.ru/get/216168/158289418.3c0/0_170316_5d47a46_orig.png
Подробнее: http://nanoworld.org.ru/post/82434/#p82434

432

Re: Формы, механизмы, энергия наномира - 84

Kushelev пишет:

Уважаемая Виктория!

Я правильно понял, что белок с последовательностью -Trp-Met-Trp-Met-

https://www.ncbi.nlm.nih.gov/bioproject/PRJNA168

ещё готовится к определению структуры? Если так, то может быть пошлём специалистам его вторичную структуру по программе Пикотех, чтобы они убедились, что мы заранее знаем структуру белка, который они только планируют исследовать?

https://img-fotki.yandex.ru/get/216168/158289418.3c0/0_170316_5d47a46_orig.png
Подробнее: http://nanoworld.org.ru/post/82434/#p82434

А ссылку на PDB?

433

Re: Формы, механизмы, энергия наномира - 84

У меня есть только эта ссылка: https://www.ncbi.nlm.nih.gov/bioproject/PRJNA168
А здесь есть ссылки, как и где я этот белок нашёл: http://nanoworld.org.ru/post/82434/#p82434

https://www.ncbi.nlm.nih.gov/protein/76 … HAN8WWW013

https://www.ncbi.nlm.nih.gov/nuccore/767936528

434

Re: Формы, механизмы, энергия наномира - 84

Kushelev пишет:

У меня есть только эта ссылка: https://www.ncbi.nlm.nih.gov/bioproject/PRJNA168
А здесь есть ссылки, как и где я этот белок нашёл: http://nanoworld.org.ru/post/82434/#p82434

https://www.ncbi.nlm.nih.gov/protein/76 … HAN8WWW013

https://www.ncbi.nlm.nih.gov/nuccore/767936528

Там целые хромосомы. Какой белок Вас интересует?

435

Re: Формы, механизмы, энергия наномира - 84

https://www.ncbi.nlm.nih.gov/nuccore/767936528

https://img-fotki.yandex.ru/get/216168/158289418.3c0/0_170316_5d47a46_orig.png

Вот его вторичная структура полностью: https://img-fotki.yandex.ru/get/197756/ … f_orig.gif

***

https://img-fotki.yandex.ru/get/195561/158289418.3c0/0_170306_707fb10f_orig.png
По второму белку информация здесь: http://nanoworld.org.ru/post/82429/#p82429

***

https://img-fotki.yandex.ru/get/98813/158289418.3c0/0_170311_330d22f5_orig.png
По третьему белку информация здесь: http://nanoworld.org.ru/post/82432/#p82432

436

Re: Формы, механизмы, энергия наномира - 84

Это по первому белку: http://www.uniprot.org/uniprot/Q3KP44#structure
Экспериментальных данных ещё нет.
Сделали только модель:
http://www.rcsb.org/pdb/explore/explore … ureId=4lg6

437

Re: Формы, механизмы, энергия наномира - 84

Victoriy пишет:

Это по первому белку: http://www.uniprot.org/uniprot/Q3KP44#structure
Экспериментальных данных ещё нет.
Сделали только модель:
http://www.rcsb.org/pdb/explore/explore … ureId=4lg6

Что-то я не могу найти последовательность аминокислотных остатков WMWM в этом белке: http://www.rcsb.org/pdb/explore/explore … ureId=4lg6

Может быть это не тот белок?

https://img-fotki.yandex.ru/get/216168/158289418.3c0/0_170316_5d47a46_orig.png

https://www.ncbi.nlm.nih.gov/nuccore/767936528

/translation="MMMRVGRHVYISQRQRASAILFMSWQESLSVTCRLWMWMTGHLC
                     TGLQLQGRPNVSSHCWSWEWTATCGTSMRARPWPMPCTAVTRRVSNSSPKRAEPTRPP
                     PSQSSRPQKKERRFNVLNQIFCKNKKEEQRAHQKDPSRDRYREEDTSEVNDIITTFDS
                     IVGTNCQEQPGDQVAMVEFKKKTSDNSKYLLPEKKPLARKGLPPIRTQSLPPITLGNN
                     FLTASHRATSHAGLSSAPHHMAQRSQKSRSEQDLLNNRTGCQMLLDNPWKSDSNQVFS
                     YKVWTVSSSDKLLDRLLSVRPGHQEVSVPPHLRHLHNPSSGQNFQHLSPNRHKIRDLP
                     FTRNNLAPLPDQKFLSGEPLRTNRVLPAIPSQRRHSTAAEESEHSANPTSDEN"

438

Re: Формы, механизмы, энергия наномира - 84

Сравните количество аминокислот и их последовательность

439

Re: Формы, механизмы, энергия наномира - 84

Что-то совсем другая последовательность аминокислот...

440

Re: Формы, механизмы, энергия наномира - 84

Формы, механизмы, энергия наномира. Сообщение 84 440

Пикотехнология белков, ДНК, РНК - 2

Кушелев: Пытаюсь найти структуру третьего лизоцима
по последовательности: CAKRVVRDPQ

https://www.ncbi.nlm.nih.gov/protein/97 … JETRSU2015

Что-то не то ищется...

Возьмём файл из архива лаборатории Наномир: http://www.nanoworld.org.ru/data/01/dat … p/casp.zip

ID   AGHLYS     standard; DNA; SYN; 509 BP.
XX
AC   X75362;
XX
DT   11-OCT-1993 (Rel. 37, Created)
DT   11-OCT-1993 (Rel. 37, Last updated, Version 1)
XX
DE   Artificial gene for human lysozyme
XX
KW   lysozyme.
XX
OS   Artificial gene
OC   Artificial sequences; Genes.
XX
RN   [1]
RA   Prodromou C., Pearl L.H.;
RT   "Recursive PCR: a novel technique for total gene synthesis";
RL   Protein Eng. 5:827-829(1992).
XX
RN   [2]
RP   1-509
RA   Prodromou C.;
RT   ;
RL   Submitted (07-OCT-1993) to the EMBL/GenBank/DDBJ databases.
RL   C. Prodromou, University College London, Biomolecular Modelling &
RL   Structure Unit, Biochemistry & Molecular Biology, Gower St., London
RL   WC1E 6BT, UK
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..509
FT                   /organism="Artificial gene"
FT   CDS             40..435
FT                   /gene="LYZ"
FT                   /EC_number="3.2.1.17"
FT                   /product="lysozyme"
FT   terminator      456..436
FT                   /note="transcription terminator region of gene 10B of
FT                   bacteriophage T7"
XX
SQ   Sequence  509 BP;  130 A; 100 C; 134 G; 145 T; 0 other;
     gaattcaaat aatttgttta actttaagga gatctacata tgaaggtttt cgaaagatgt
     gagctcgcta gaaccttgaa gagattgggt atggacgggt accgtggtat ctctttggct
     aactggatgt gtttggctaa gtgggaatct ggttacaaca ctcgagctac caactacaac
     gctggtgaca ggtcgaccga ctacggtatc ttccaaatta attctagata ctggtgtaac
     gacggtaaga ccccaggcgc cgttaacgct tgtcacttgt cttgttctgc tttgctgcag
     gacaacatcg ctgacgctgt tgcttgtgct aaacgcgttg ttagagaccc acaaggtatc
     agagcttggg ttgcttggag aaatcgatgt caaaacagag acgtcagaca atacgttcaa
     ggttgtggtg tttagtaagg atcctctaga ataacccctt ggggcctcta aacgggtctt
     gaggggtttt tgctccatgg aggaagctt
//

Композиционный код:

1,1,3,1,3,3,3,1,1,3,3,1,1,1,3,1,3,1,1,4,1,3,3,1,3,1,3,1,1,1,3,1,3,1,1,3,3,3,1,1,3,2,3,1,1,1,1,3,3,1,
1,4,1,1,1,3,1,1,3,3,3,3,3,1,1,3,1,1,3,1,1,2,1,1,3,1,3,3,1,1,3,3,3,3,1,4,1,1,1,1,3,1,3,3,3,3,3,3,1,3,
3,3,1,2,3,3,1,3,3,1,3,3,1,3,3,2,3,3,1,3,1,1,3,3,1,3,3,3,3,3,3

Вторичная структура (Пикотех): https://img-fotki.yandex.ru/get/29473/1 … f_orig.gif

Фрагмент, замкнутый через дисульфидный мостик:

https://img-fotki.yandex.ru/get/195786/158289418.3c1/0_170441_466f62e4_orig.png

http://www.nanoworld.org.ru/data/01/data/images/slides/990709/001.jpg
http://www.nanoworld.org.ru/data/01/data/images/slides/990709/1.gifhttp://www.nanoworld.org.ru/data/01/data/images/slides/990709/002.jpg

N1 Это у нас первый лизоцим (фрагмент 22 ао). Вроде бы тоже человеческий, но какой-то синтетический. Возможно, что древний. Научная статья на эту тему: http://onlinelibrary.wiley.com/doi/10.1 … 4857.x/pdf

***
N2 http://nanoworld.org.ru/topic/1530/page/96/
http://www.ebi.ac.uk/ena/data/view/AAA36188
>ENA|AAA36188|AAA36188.1 Homo sapiens (human) hypothetical protein
ATGAAGGCTCTCATTGTTCTGGGGCTTGTCCTCCTTTCTGTTACGGTCCAGGGCAAGGTC
TTTGAAAGGTGTGAGTTGGCCAGAACTCTGAAAAGATTGGGAATGGATGGCTACAGGGGA
ATGAGCCTAGCAAACTGGATGTGTTTGGCCAAATGGGAGAGTGGTTACAACACACGAGCT
ACAAACTACAATGCTGGAGACAGAAGCACTGATTATGGGATATTTCAGATCAATAGCCGC
TACTGGTGTAATGATGGCAAAACCCCAGGAGCAGTTAATGCCTGTCATTTATCCTGCAGT
GCTTTGCTGCAAGATAACATCGCTGATGCTGTAGCTTGTGCAAAGAGGGTTGTCCGTGAT
CCACAAGGCATTAGAGCATGGGTGGCATGGAGAAATCGTTGTCAAAACAGAGATGTCCGT
CAGTATGTTCAAGGTTGTGGAGTGTAA
Вторичная структура лизоцима N2 (Пикотех): https://img-fotki.yandex.ru/get/172684/ … 7_orig.gif

https://img-fotki.yandex.ru/get/112776/158289418.3bf/0_1702fc_2f73e792_orig.png

https://img-fotki.yandex.ru/get/218579/158289418.3b3/0_16f621_2cbc61c5_XL.png

https://img-fotki.yandex.ru/get/169883/158289418.3b3/0_16f622_63ae0418_orig.gif

N2 Это - человеческий лизоцим (фрагмент 19 ао).

***
N3 Это - лизоцим куриного яйца
http://www.rcsb.org/pdb/explore/explore … ureId=132L

http://www.uniprot.org/uniprot/P00698

http://www.ebi.ac.uk/ena/data/view/AAA48943

>ENA|AAA48943|AAA48943.2 Gallus gallus (chicken) hypothetical protein
ATGAGGTCTTTGCTAATCTTGGTGCTTTGCTTCCTGCCCCTGGCTGCTCTGGGGAAAGTC
TTTGGACGATGTGAGCTGGCAGCGGCTATGAAGCGTCACGGACTTGATAACTATCGGGGA
TACAGCCTGGGAAACTGGGTGTGTGCCGCAAAATTCGAGAGTAACTTCAACACCCAGGCT
ACAAACCGTAACACCGATGGGAGTACCGACTACGGAATCCTACAGATCAACAGCCGCTGG
TGGTGCAACGATGGCAGGACCCCAGGCTCCAGGAACCTGTGCAACATCCCGTGCTCAGCC
CTGCTGAGCTCAGACATAACAGCGAGCGTGAACTGCGCGAAGAAGATCGTCAGCGATGGA
AACGGCATGAACGCGTGGGTCGCCTGGCGCAACCGCTGCAAGGGCACCGACGTCCAGGCG
TGGATCAGAGGCTGCCGGCTGTGA

https://img-fotki.yandex.ru/get/105284/158289418.3bf/0_1702fb_aff0e48a_orig.png
Вторичная структура полностью: https://img-fotki.yandex.ru/get/125649/ … 3_orig.gif
Подробнее: http://nanoworld.org.ru/topic/1530/page/97/

N3 Это - лизоцим куриного яйца (фрагмент 19 ао). Надо его тоже проверить на замыкание в 3D версии пикотех smile