341

Re: Формы, механизмы, энергия наномира - 84

https://blast.ncbi.nlm.nih.gov/Blast.cgi

https://www.ncbi.nlm.nih.gov/protein/10 … C0A790J015

https://www.ncbi.nlm.nih.gov/nuccore/740086722

FT CDS 4682..4916
        1 ggggcgcgga gccctgctct cgcaactcaa gatggcggac gagagtgaga cagcagtgaa
       61 gccgccggca cctccgctgc cgcagatgat ggaagggaac gggaacggcc atgagcactg
      121 cagcgattgc gagaatgagg aggacaacag ctacaaccgg ggtggtttga gtccagccaa
      181 tgacactgga gccaaaaaga agaaaaagaa acaaaaaaag aagaaagaaa aaggcagtga
      241 gacagattca gcccaggatc agcctgtgaa gatgaactct ttgccagcag agaggatcca
      301 ggaaatacag aaggccattg agctgttctc agtgggtcag ggacctgcca aaaccatgga
      361 ggaggctagc aagcgaagct accagttctg ggatacgcag cccgtcccca agctgggcga
      421 agtggtgaac acccatggcc ccgtggagcc tgacaaggac aatatccgcc aggagcccta
      481 caccctgccc cagggcttca cctgggatgc tttggacctg ggcgatcgtg gtgtgctaaa
      541 agaactgtac accctcctga atgagaacta tgtggaagat gatgacaaca tgttccgatt
      601 tgattattcc ccggagtttc ttttgtgggc tctccggcca cccggctggc tcccccagtg
      661 gcactgtggg gttcgagtgg tctcaagtcg gaaattggtt gggttcatta gcgccatccc
      721 agcaaacatc catatctatg acacagagaa gaagatggta gagatcaact tcctgtgtgt
      781 ccacaagaag ctgcgttcca agagggttgc tccagttctg atccgagaga tcaccaggcg
      841 ggttcacctg gagggcatct tccaagcagt ttacactgcc ggggtggtac taccaaagcc
      901 cgttggcacc tgcaggtatt ggcatcggtc cctaaaccca cggaagctga ttgaagtgaa
      961 gttctcccac ctgagcagaa atatgaccat gcagcgcacc atgaagctct accgactgcc
     1021 agagactccc aagacagctg ggctgcgacc aatggaaaca aaggacattc cagtagtgca
     1081 ccagctcctc accaggtact tgaagcaatt tcaccttacg cccgtcatga gccaggagga
     1141 ggtggagcac tggttctacc cccaggagaa tatcatcgac actttcgtgg tggagaacgc
     1201 aaacggagag gtgacagatt tcctgagctt ttatacgctg ccctccacca tcatgaacca
     1261 tccaacccac aagagtctca aagctgctta ttctttctac aacgttcaca cccagacccc
     1321 tcttctagac ctcatgagcg acgcccttgt cctcgccaaa atgaaagggt ttgatgtgtt
     1381 caatgcactg gatctcatgg agaacaaaac cttcctggag aagctcaagt ttggcatagg
     1441 ggacggcaac ctgcagtatt acctttacaa ttggaaatgc cccagcatgg gggcagagaa
     1501 ggttggactg gtgctacaat aaccagtcac cagtgcgatt ctggataaag ccactgaaaa
     1561 ttcgaaccag gaaatggaac cccaccactg ttggtccaat tttcacacac gtgagaatcc
     1621 ctggcaaagg gagcagaact gaaccggctt taccaaaccg ccagcgaact tgacaattgt
     1681 attgcgatgg cgtgggctgc gtgacgtcac ctccggtcgt gtctctggtc tccgtgtttt
     1741 ccagttaatt acatcctcat gcagccgtga tcaagggaat gtaactgctg aaaactagct
     1801 cgtgattggc atataatgga gttaacgggt gaataataaa agtatatata tatattatat
     1861 atatataaat attttaaata tctttcatgt tccaaatgta caaggatgtt tggtctttaa
     1921 tgaaaagctg aatccagatc attcctcaga atgaggaccc gaggacagtg gcagacagac
     1981 gcgttggcac agttcatggt ttcctccaga ggagacattg gcttatcatg gggaaaaaga
     2041 ggatctggag aacctcatcc agctcccctt ctgaatcagc tgggatgact ggctttgaga
     2101 aggaagggaa gatggaacag gctcagatct catgggatag cacgtggagc tcttggctgg
     2161 ggctgaccct gggcagggac tttcctgcag ggccagacct gcctgcattc tgagacaaag
     2221 caatggacgg tccgcagaag cagacctcat tgattgagtc ctttcttcca tccccttggc
     2281 ctgctccctg taggaagtca tcctgccaac tgatttaaaa gggctcttta gccagttgtt
     2341 gccaacctta tagggatgag tcccctgtga gattttgctt ttccactgcc tgggatgatg
     2401 cagtttgaag aggcccttgg acctccttgt aacatcaggg acctttggag accattatca
     2461 gtgtaagccc tgcttagctc atcttagagc aaagagccag caccctgatg tccctggggt
     2521 ggctaggcag gagtggcgtg gggccaatac ccagacccct tcagccacca gcccctggcc
     2581 tgtgccttcc aacccattag ccatttcttg ttgtgcccct ttccaagata cagcctgcaa
     2641 gtggtagcaa gaagtgatta gaggcagatc tggacttggc aacagaagtg gtttcccatc
     2701 tccattgtct gagtctgatt ttcgctgatg ctgttttgtg gatttttgtg gtagtgatgg
     2761 ttgtcagtgc tgccagtttc ccaaaacgta atcaagcctc tggtcacatg gctgtcgatg
     2821 taggcattct ggagtggtgt tcagccaagt gaccgggcaa aattgggctg tgaaattgta
     2881 cttccaggct tggatgtaat ttttgctcta gagagaagca agtggtggga aggaggtagc
     2941 atgacgtgtg gtgtgcgggt ttccttgctg ccgtcacctc tccgctcata caggaatgaa
     3001 gccttagcca ggaggccagg ctcagccctg tgccactcac cgaagccact ttctacaggc
     3061 cagcaggggc ttgttgcagg ctgtgggttt tggtgtggtt tgtcagaggc taattctgca
     3121 gagtttccaa aaccagaaga catcgtatgc ttgggatggg ggccgtgcca cccgtgggaa
     3181 tgctgcccgc tctgcagact gctgctagag ccagcaactc cactaaggtg gattttcatc
     3241 aggggcctgc agggccctcc cttttcccat tgttcctgcg ctgcaaattg caggccccag
     3301 caatcgtgac tgacgtttgc tccttgactc caagaaactg agaccaaaga agctgctgtt
     3361 cttagcaaga tgcgcactgc attccacagg tgggaggagt cggagaggca ggggcttgct
     3421 ttgcagcccc acagacaaca gttgcacagt gcctcaagcc ccagagtggc tcaccctgtc
     3481 cagacctttg aggatatcaa aggacaaagt gcccaagtct ttcctacctt gggggaacct
     3541 ggaacttgga aaggctccct gtcctagtct tgatctgttc tgggccaggt cccagcttga
     3601 gctgcctctg agatttgggc tgtgcggatc tctggagtga gctctgtttc ggttgaccca
     3661 ggtcatggaa tggaaacggt gaggccccag tggctgttct ggaagaaaca gatctcctgg
     3721 caaaggcccc agcatctccc tcactgaaac caggtggccg gctcctcgga ctctgcttta
     3781 tgttgcggtg agaactctgc ccaggtgtgc agggtttggc ttgtgggctg cttgctgctc
     3841 atctgatttt tgtcccagta gtccctgcgt tcttcattca accccttctg ggacttcagc
     3901 tcagagagca ccatcccggg ggtcagggcc tccccacagg agccctgcag tgtggtagcg
     3961 ccatggctgt ctcaaaccaa gcaaaggaag gaccctgagg ccttcacgct aaccgtcctc
     4021 gagcaactgc tgttggaagg cctccctggg cctggccccc accctctgcc acccagtcct
     4081 cccagctgcc atgtttcaaa gacgaccttt acctcctgcc tttggattga ctctgcattt
     4141 gaccacggac tccagtctgt gtgtagggag agagctgagt aggaggcctc cactccggat
     4201 cgaggcctgt atagggctcg tttccccaca catgcctatt tctgaagagg cttctgtctt
     4261 atttgaaggc cagcccacac ccagctactt taacaccagg tttatggaaa atgtcaggcc
     4321 ttccccacaa ctcctgtcta actgctgtcg cccccctact tgctggctct cagaagccta
     4381 ggggagtccc tgtggtcctg aattctttcc ccaaagacga ccagcattta accaacctaa
     4441 gggcccaaag gccttggaca actgcatgga gctgcactct aggagaagga ggggaaccag
     4501 atgttagatc aggggaggga gcaggagtgt ccctcccgtc agtgcctacc cacctgtgag
     4561 gcagccttct gatggcctgg cccaccttcc ccagaaccag gggaggcctg aggcttcagt
     4621 tttactctgc tgcaaaatga aggcgggcct gcaagccgac tacacctacg gaggctgttg
     4681 aggacaattt cattccatta aattaaaaaa tactgactgg ctggcaggca ggtgccatgt
     4741 ctgggaacag ggacggggga gcttcacctt tttgtcttgg cttttctttg ggctgtgggg
     4801 gggcatccat ttccagggtc ggggaggaaa taccaaatgc attgttgttc tgctcaatac
     4861 atctcacttg tttctaataa agaaagcagc tgaacaaaaa aaaaaaaaaa aaaaaa
//

https://img-fotki.yandex.ru/get/54905/158289418.3be/0_17013a_7f0efb38_orig.gif

Окончание аминокислотной последовательности: HLFLIKKAAEQKKKKKK

342

Re: Формы, механизмы, энергия наномира - 84

https://www.ncbi.nlm.nih.gov/protein/45 … CR2ZZS6015

https://www.ncbi.nlm.nih.gov/nuccore/197927158

FT CDS 197..3304
        1 aggaggggaa gtgagtggtt agacctcagc tcatctgagg gctaaaggtt ctttgtgaca
       61 catcacacag aattggagtg ctgtccttct ggagagtggt ggagaaccaa gatacagttc
      121 agaaccaaag gaatagagaa gggctttgat ttctttttgg ctttagattg gggatttggg
      181 aggcttagca ggaaagatgt ccactgaaaa tgtggaaggg aagcccagta accttgggga
      241 gagaggaaga gcccggagct ccactttcct cagggttgtc cagccaatgt ttaaccacag
      301 tattttcact tctgcagtct ctcctgctgc agaacgcatc cgattcatct tgggagagga
      361 ggatgacagc ccagctcccc ctcagctctt cacggaactg gatgagctgc tggccgtgga
      421 tgggcaggag atggagtgga aggaaacagc caggtggatc aagtttgaag aaaaagtgga
      481 acagggtggg gaaagatgga gcaagcccca tgtggccaca ttgtcccttc atagtttatt
      541 tgagctgagg acatgtatgg agaaaggatc catcatgctt gatcgggagg cttcttctct
      601 cccacagttg gtggagatga ttgttgacca tcagattgag acaggcctat tgaaacctga
      661 acttaaggat aaggtgacct atactttgct ccggaagcac cggcatcaaa ccaagaaatc
      721 caaccttcgg tccctggctg acattgggaa gacagtctcc agtgcaagta ggatgtttac
      781 caaccctgat aatggtagcc cagccatgac ccataggaat ctgacttcct ccagtctgaa
      841 tgacatttct gataaaccgg agaaggacca gctgaagaat aagttcatga aaaaattgcc
      901 acgtgatgca gaagcttcca acgtgcttgt tggggaggtt gactttttgg atactccttt
      961 cattgccttt gttaggctac agcaggctgt catgctgggt gccctgactg aagttcctgt
     1021 gcccacaagg ttcttgttca ttctcttagg tcctaagggg aaagccaagt cctaccacga
     1081 gattggcaga gccattgcca ccctgatgtc tgatgaggtg ttccatgaca ttgcttataa
     1141 agcaaaagac aggcacgacc tgattgctgg tattgatgag ttcctagatg aagtcatcgt
     1201 ccttccacct ggggaatggg atccagcaat taggatagag cctcctaaga gtcttccatc
     1261 ctctgacaaa agaaagaata tgtactcagg tggagagaat gttcagatga atggggatac
     1321 gccccatgat ggaggtcacg gaggaggagg acatggggat tgtgaagaat tgcagcgaac
     1381 tggacggttc tgtggtggac taattaaaga cataaagagg aaagcgccat tttttgccag
     1441 tgatttttat gatgctttaa atattcaagc tctttcggca attctcttca tttatctggc
     1501 aactgtaact aatgctatca cttttggagg actgcttggg gatgccactg acaacatgca
     1561 gggcgtgttg gagagtttcc tgggcactgc tgtctctgga gccatctttt gcctttttgc
     1621 tggtcaacca ctcactattc tgagcagcac cggacctgtc ctagtttttg agaggcttct
     1681 atttaatttc agcaaggaca ataattttga ctatttggag tttcgccttt ggattggcct
     1741 gtggtccgcc ttcctatgtc tcattttggt agccactgat gccagcttct tggttcaata
     1801 cttcacacgt ttcacggagg agggcttttc ctctctgatt agcttcatct ttatctatga
     1861 tgctttcaag aagatgatca agcttgcaga ttactacccc atcaactcca acttcaaagt
     1921 gggctacaac actctctttt cctgtacctg tgtgccacct gacccagcta atatctcaat
     1981 atctaatgac accacactgg ccccagagta tttgccaact atgtcttcta ctgacatgta
     2041 ccataatact acctttgact gggcattttt gtcgaagaag gagtgttcaa aatacggagg
     2101 aaacctcgtc gggaacaact gtaattttgt tcctgatatc acactcatgt cttttatcct
     2161 cttcttggga acctacacct cttccatggc tctgaaaaaa ttcaaaacta gtccttattt
     2221 tccaaccaca gcaagaaaac tgatcagtga ttttgccatt atcttgtcca ttctcatctt
     2281 ttgtgtaata gatgccctag taggcgtgga caccccaaaa ctaattgtgc caagtgagtt
     2341 caagccaaca agtccaaacc gaggttggtt cgttccaccg tttggagaaa acccctggtg
     2401 ggtgtgcctt gctgctgcta tcccggcttt gttggtcact atactgattt tcatggacca
     2461 acaaattaca gctgtgattg taaacaggaa agaacataaa ctcaagaaag gagcagggta
     2521 tcacttggat ctcttttggg tggccatcct catggttata tgctccctca tggctcttcc
     2581 gtggtatgta gctgctacgg tcatctccat tgctcacatc gacagtttga agatggagac
     2641 agagacttct gcacctggag aacaaccaaa gtttctagga gtgagggaac aaagagtcac
     2701 tggaaccctt gtgtttattc tgactggtct gtcagtcttt atggctccca tcttgaagtt
     2761 tatacccatg cctgtactct atggtgtgtt cctgtatatg ggagtagcat cccttaatgg
     2821 tgtgcagttc atggatcgtc tgaagctgct tctgatgcct ctgaagcatc agcctgactt
     2881 catctacctg cgtcatgttc ctctgcgcag agtccacctg ttcactttcc tgcaggtgtt
     2941 gtgtctggcc ctgctttgga tcctcaagtc aacggtggct gctatcattt ttccagtaat
     3001 gatcttggca cttgtagctg tcagaaaagg catggactac ctcttctccc agcatgacct
     3061 cagcttcctg gatgatgtca ttccagaaaa ggacaagaaa aagaaggagg atgagaagaa
     3121 aaagaaaaag aagaagggaa gtctggacag tgacaatgat gattctgact gcccatactc
     3181 agaaaaagtt ccaagtatta aaattccaat ggacatcatg gaacagcaac ctttcctaag
     3241 cgatagcaaa ccttctgaca gagaaagatc accaacattc cttgaacgcc acacatcatg
     3301 ctgataaaat tcctttcctt cagtcactcg gtatgccaag tcctcctaga actccagtaa
     3361 aagttgtgcc tcaaattaga atagaacttg aacctgaaga caatgattat ttctggagga
     3421 gcaagggaac agaaactaca ttgtaacctg tttgtctttc ttaaaactga catttgttgt
     3481 taatgtcatt tgtttttgtt tggctgtttg tttatttttt aacttttatt tcgtctcagt
     3541 ttttggtcac aggccaaata atacagcgct ctctctgctt ctctcttgca tagatacaat
     3601 caagacaata gtgcaccgtt ccttaaaaac agcatctgag gaatccccct tttgttctta
     3661 aactttcaga tgtgtccttt gataaccaaa ttctgtcact caagacacag acacgcacag
     3721 accctgtcct ttgcctctat taagcagagg atggaagtat taaggatttt gtaacacctt
     3781 ttatgaaaat gttgaaggaa cttaaaactt tagctttgga gctgtgctta ctggcttgtc
     3841 tttgtctggt agaacaaacc ttgacctcca gacagagtcc cttctcactt atagagctct
     3901 ccaggactgg aaaaagtgct gctattttaa cttgctcttg cttgtaaatc ctaatcttag
     3961 agttatcaaa agaagaaaaa actgaaggta ctttactccc tatagagaaa ccattgccat
     4021 cattgtagca agtgctggaa tgtccctttt ttcctatgca acttttttta accctttaat
     4081 gaacttatct gttgagtaca ttgaagaata tttttcttcc tagattttgt tgtttaaatt
     4141 atggggccta acctgccact tattttttgt caatttttaa aacttttttt taattactgt
     4201 aaagaaaatg aattttttcc tgcagcagga aacatagttt tgagtagttc tacctcttat
     4261 ttgtagctgc caggctttct gtaaaaattg tattgtatat aatgtgattt ttacacatac
     4321 atacacacac aaatacacaa tctctagggt aagccagaag gcaagatcag attaaaaaca
     4381 ccatgtttct aagcatccat ttttcccttt ctttaaaaga aacttaactg ttctatgaag
     4441 gagattgagg gagaagagac aaactcctat gtcatgagaa taaccgatgt tctgataata
     4501 gtagcatcta ggtacagatg ctggttgtat taccacgtca atgtcctatg cagtattgtt
     4561 agacattttc tcattttgaa atatttgtgt gtttgtgtat gtgctctgtg ccatggctgg
     4621 tgtatatatg tgcaatgtta gaaggcaaaa gagtgatggt aggcagaggg caaagtcatt
     4681 gaatctctta tgccagtttt cataaaaccc aaaccacata tgaaaaaatc cattaagggt
     4741 ccaagaagtc tgtccatatg aaaatgaggg taaatatagt ttatttccca ggtatcagtc
     4801 attataattg atataatagc tctaacatgc aatataaaat tcataggagt attaatagcc
     4861 catttacaca tctataaaat gtaatgggat tgcagagctg cagagtacag tgtaacagta
     4921 ctctcatgca atttttttca ggatgcaaag gcaattattc tttgtaagcg ggacatttag
     4981 aatatatttg tgtacatatt atatgtatgt atatttcaaa gtaccacact gaaaattaga
     5041 catttattaa ccaaatttaa cgtggtattt aaaggtaata tttttaatat gatacattac
     5101 atattgtgaa tgtatactaa aaaaacattt taaatgttaa aattataatt tcagattcat
     5161 ataaccacaa ctgtgatata tcctaactat aaccagttgt tgaggggtat actagaagca
     5221 gaatgaaacc acattttttg gtttgataat atgcacttat tgactcccac tcattgttat
     5281 gttaattaag ttattattct gtctccttgt aattttgatt acaaaaattt tattatcctg
     5341 agttagctgt tacttttaca gtacctgata ctcctaaaac ttttaactta tacaaattag
     5401 tcaataatga ccccaatttt ttcattaaaa taatagtggt gaattatatg ttattgtgtt
     5461 aaaacctcac ttgccaaatt ctggcttcac atttgtattt agggctatcc ttaaaatgat
     5521 gagtctatat tatctagctt tctattaccc taatataaac tggtataaga agactttcct
     5581 tttttcttta tgcatggaag catcaataaa ttgtttaaaa accatgtata gtaaattcag
     5641 cttaacccgt gatcttctta agttaaaggt acttttgttt tataaaagct ctagataaaa
     5701 ctttcttttc tgatcatgaa tcaagtatct gtggtttcat gcccctctct atacctttca
     5761 aagaactcct gaagcaactt aactcatcat ttcagcctct gagtagaggt aaaacctatg
     5821 tgtacttctg tttatgatcc atattgatat ttatgacatg aacacagaat agtaccttac
     5881 atttgctaaa cagacagtta atatcaaatc ctttcaatat tctgggaacc cagggaagtt
     5941 tttaaaaatg tcattacttt caaaggaaca gaagtagtta accaaactaa caagcaaaac
     6001 ctgaggttta cctagtgaca ccaaattatc ggtattttaa ctgaatttac ccattgacta
     6061 agaatgaacc agatttggtg gtggttttgt ttctatgcaa actggacaca aattacaaca
     6121 gtaaattttt ttataagtgc ttctcccttc tccatgatgt gacttccgga gataaaggat
     6181 tcaaaagata aagacaaagt acgctcagag ttgttaacca gaaagtcctg gctgtggttg
     6241 cagaaacact gttggaagaa aagagatgac taagtcaagt gtctgcctta tcaaaagagc
     6301 aaaaatgcct ctggttttgt gtttgggaga aaaatatctt ggacgcactg ttttccttga
     6361 taaaagtcat cttctctact gtgtgaaatg aatacttgga attctaattg ttttgtgtgc
     6421 caggggcagt aatgtccctg cctcttctcc caatcaaggt tgaggagtgg ggctggggag
     6481 aggacttaac tgacttaaga agtaggaaaa caaaaacctc tctcctcagc cttccacctc
     6541 caagagagga ggaaaaacag ttgtctgctg tctgtaattc agtttgcgtg tattttatgc
     6601 tcatgcacca acccatacag agtaaatctt ttatcaacta tatactggtg tttaatagag
     6661 aatgattgtc ttccgagttt tttggttcct tttttaactg tgttaaagta cttgaaatgt
     6721 attgactgct gactatattt taaaaacaaa atgaaataat ttgagttgta ttacagaggt
     6781 tgacattgtt cagggatggg acaaagcctt cttcaatcct tttcatacta cttaatgatt
     6841 ttggtgcagg aacctgagat tttctgattt atatttcatg atatttcaca tttgctcttc
     6901 acagcatgag catgaagccc agtggcacca aatggctggg tacaatcaag tgatattttg
     6961 tagcacctca ctatctgaaa ggccatgagt tttcagatga tttcattgag cttcattgca
     7021 gcctgaaatt ttaaaaaagt tgtgtaatac gccaaccagt caagttgtgt tttggccaga
     7081 gatttagata tgtccaattt cctggctcat ttcattgtgc tctatgggta cgtataaaaa
     7141 gcaagaattc tgtttcctag gcaaacattg caactcaggg ctaaagtcat ccagtgaaac
     7201 ttttagagcc agaagtaact ttgtcccagt cctacaatgt gaaaagagtg aatagttgcc
     7261 tctttttagc cattttcatg gctggtacat attcgtacgc attacttttc agaatcaata
     7321 cgcactttca gatattctta tttttattct cttaagtctt tattaacttt ggagagagaa
     7381 atgatgcatc tttttatttt aaatgaagta gatcaacatg gtggaacaaa atgataaaga
     7441 acagaaaaca tttcaatata ttactaataa ctttttccaa tataaatcct aaaattccta
     7501 taacatagta ttttacagtt ttatgaagct ttctattgtg acttttatgg aattaagaga
     7561 tgaagaagat gagatatttt agcatttata tttttcaaaa ttatatgtat acttaaaaat
     7621 aaagtaactt tatgcattta
//

https://img-fotki.yandex.ru/get/224193/ … d_orig.gif

https://img-fotki.yandex.ru/get/197741/158289418.3be/0_17013b_2285997_orig.png

https://img-fotki.yandex.ru/get/198786/158289418.3be/0_17013c_206a805b_orig.png

343

Re: Формы, механизмы, энергия наномира - 84

https://www.ncbi.nlm.nih.gov/protein/13 … CR2ZZS6015

https://www.ncbi.nlm.nih.gov/nuccore/133908640

FT CDS             52..3477
        1 ggcctagcgg gacgcggctg cggtcagagg agcaggagga ggtcccccga catgcctgag
       61 gcaaaaccag cggccaaaaa ggcccccaaa ggcaaagatg cccccaaagg agcccccaag
      121 gaggctcccc ctaaggaggc tcctgcagag gcccccaaag aagccccacc cgaggaccag
      181 tccccgactg cagaggagcc caccggcgtt ttcctgaaga agccggactc cgtctcagtg
      241 gagactggga aggacgcagt ggtcgtggcc aaggtgaacg ggaaggagct cccagacaaa
      301 ccgaccatca agtggttcaa ggggaagtgg ctggagctgg gcagcaagag tggcgcccgc
      361 ttctccttca aggagtccca caactccgcc agcaatgtgt acaccgtgga gctgcacatt
      421 gggaaggtgg tactggggga ccgtgggtat taccgcctcg aggtcaaagc caaggacacc
      481 tgtgacagct gtggcttcaa catcgatgtg gaggcacccc gtcaggatgc ctctgggcag
      541 agtctagaaa gcttcaagcg tacgagtgaa aagaagtcgg atactgcagg tgagctggat
      601 ttcagtggcc tgttgaagaa gagggaggtg gtggaggagg agaagaagaa gaaaaagaaa
      661 gatgacgatg acctaggcat ccccccggag atttgggagc tcctgaaagg ggcaaagaag
      721 agcgagtacg agaaaatcgc cttccagtat ggcatcaccg acctccgggg catgctgaag
      781 cggctgaaaa aggctaaggt cgaggtcaag aagagtgcag cattcacaaa gaagctggat
      841 ccagcctacc aagtggacag aggcaacaag atcaagttga tggtagagat cagcgaccca
      901 gacctgaccc tcaagtggtt caagaacggc caggagatca aaccaagcag caagtacgtg
      961 tttgagaacg ttggtaagaa gcgaattctt accatcaaca agtgcacgct ggcggatgac
     1021 gctgcctatg aagtagctgt caaggatgag aagtgtttca ccgagctctt cgtcaaagaa
     1081 cctccagtcc taattgtcac acctcttgag gaccagcagg tgtttgtggg tgaccgggtg
     1141 gaaatggcag tggaggtgtc agaagagggt gcccaggtga tgtggatgaa agatggtgtg
     1201 gaactgactc gggaggattc cttcaaggcc cggtaccgct tcaagaagga cgggaagcgc
     1261 cacatcctca tcttctcaga cgtggtccag gaggacaggg gtcgctatca ggtcataacc
     1321 aatggcggcc agtgtgaggc cgagctgatt gtggaagaga aacagctgga ggtcctgcag
     1381 gacatcgcgg atctgacggt gaaggcctca gaacaagctg tgttcaagtg cgaggtgtct
     1441 gatgagaaag tgacgggcaa gtggtataag aatggggtcg aggtgcggcc cagcaagagg
     1501 atcaccattt cccatgtagg caggttccac aagctggtga tcgatgacgt ccgccccgag
     1561 gatgagggag actacacgtt tgtgcctgac ggctacgccc tgtcgctctc ggccaagctc
     1621 aacttcctgg aaatcaaggt ggagtacgtt cccaagcaag agccaccaaa gatccacttg
     1681 gattgctcgg ggaagacctc agagaatgcg attgtggttg tggctggaaa caagctgagg
     1741 cttgacgtgt ccatcacagg ggagccccct cccgtcgcta cctggctgaa gggagatgag
     1801 gtattcacga ccaccgaggg caggacccgc atcgagaagc gggtggactg cagcagcttt
     1861 gtgattgaga gtgcgcagcg ggaagacgag ggccgctaca ccatcaaggt caccaacccc
     1921 gtcggcgagg acgtggcttc catcttcctg caagttgtag atgtcccaga ccccccggag
     1981 gctgtgcgca tcacctcggt tggagaggat tgggccatcc ttgtctggga gccaccaatg
     2041 tacgatgggg ggaagccagt caccgggtac ctcgtagagc ggaagaagaa gggctctcag
     2101 cgctggatga agctgaactt tgaggtcttc acagagacca cctatgagtc caccaagatg
     2161 atcgagggca tcctctatga gatgcgtgtc ttcgccgtca atgctatagg ggtctcccag
     2221 cccagcatga acaccaagcc ttttatgcct attgcaccca cgagtgaacc cctgcacctg
     2281 atagtggagg atgtgacaga caccaccacc acactcaagt ggaggcctcc gaacaggatc
     2341 ggggcaggtg gcatcgatgg gtacctggtg gagtactgcc tggaaggctc cgaggaatgg
     2401 gtccctgcca acaccgagcc cgtggagcgc tgtggcttca ccgtcaagaa tctcccgacc
     2461 ggagccagaa tcctcttccg agtagttggg gtcaacatcg cggggcgcag cgagccggcc
     2521 accctggccc agccggtcac catcagggag attgcggagc cacccaagat ccggcttccc
     2581 cgccatctcc gccagaccta catccgcaaa gtgggcgagc agctcaacct tgtcgtcccc
     2641 ttccagggaa agccccggcc ccaggtggtg tggaccaagg gcggggcccc gctggacacc
     2701 tcccgcgtgc acgtgcggac cagcgacttc gacaccgtgt tcttcgtgcg ccaggcggcc
     2761 cgctccgact ccggggagta cgagctgagc gtgcagatcg agaacatgaa ggacaccgcc
     2821 accatccgca tccgcgttgt ggaaaaggct gggcccccca taaacgtgat ggtgaaggag
     2881 gtgtggggca cgaacgcgct ggtggagtgg caggccccca aagatgatgg gaacagtgag
     2941 atcatggggt atttcgtcca gaaagcagac aaaaaaacca tggagtggtt caacgtctat
     3001 gaacgtaaca ggcacactag ctgtactgtg tccgacctta tcgtgggcaa tgaatactat
     3061 ttccgagttt acaccgagaa catctgtggg ctcagtgact cacctggtgt ctccaagaac
     3121 acggcccgca tcctcaagac aggaatcacc ttcaaaccgt tcgagtataa ggagcatgac
     3181 ttccggatgg ctcccaagtt cctgacacct ctcatagacc gcgtggtcgt ggctgggtac
     3241 tcggcagccc tcaactgtgc tgtcagaggc cacccgaagc cgaaggtggt ctggatgaag
     3301 aacaagatgg aaatccgtga agatcccaag ttcctgataa ccaattacca aggagtcctg
     3361 acgctgaaca tccgtcgccc ctcgcccttc gacgctggga cttacacctg ccgggccgtc
     3421 aacgagctgg gcgaggcgct ggctgagtgc aagctggagg tccgagtgcc gcagtgagac
     3481 ctgtccccta cctgccaaga caattggtgg tggagtcctg accccaatcc ccaacctccc
     3541 aggactgtgt tctttctgga gttttcgctg agaacaaaac agtgttgtct ggaccctg
//

344

Re: Формы, механизмы, энергия наномира - 84

Формы, механизмы, энергия наномира. Сообщение 84 344

Пикотехнология белков, ДНК, РНК - 2

https://www.ncbi.nlm.nih.gov/protein/10 … CR2ZZS6015

https://www.ncbi.nlm.nih.gov/protein/11 … CR2ZZS6015

     CDS             1..381
        1 maspslerpe kgagksefrn qkpkpenqde selltvpdgw kepafskedn prglleessf
       61 atlfpkyrea ylkecwplvq kalnehhvna tldliegsmt vcttkktfdp yiiirardli
      121 kllarsvsfe qavrilqddv acdiikigsl vrnkerfvkr rqrligpkgs tlkalelltn
      181 cyimvqgntv saigpfsglk evrkvvldtm knihpiynik slmikrelak dselrsqswe
      241 rflpqfkhkn vnkrkepkkk tvkkeytpfp ppqpesqidk elasgeyflk anqkkrqkme
      301 aikakqaeai skrqeernka fippkekpiv kpkeastetk idvasikekv kkaknkklga
      361 ltaeeialkm eadekkkkkk k
//

https://www.ncbi.nlm.nih.gov/nuccore/117676402

Homo sapiens KRR1, small subunit processome component homolog (KRR1), mRNA
NCBI Reference Sequence: NM_007043.6
FASTA Graphics
Go to:
LOCUS       NM_007043               3357 bp    mRNA    linear   PRI 10-SEP-2016
DEFINITION  Homo sapiens KRR1, small subunit processome component homolog
            (KRR1), mRNA.
ACCESSION   NM_007043
VERSION     NM_007043.6
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3357)
  AUTHORS   Evans DM, Zhu G, Dy V, Heath AC, Madden PA, Kemp JP, McMahon G, St
            Pourcain B, Timpson NJ, Golding J, Lawlor DA, Steer C, Montgomery
            GW, Martin NG, Smith GD and Whitfield JB.
  TITLE     Genome-wide association study identifies loci affecting blood
            copper, selenium and zinc
  JOURNAL   Hum. Mol. Genet. 22 (19), 3998-4006 (2013)
   PUBMED   23720494
REFERENCE   2  (bases 1 to 3357)
  AUTHORS   Baltz AG, Munschauer M, Schwanhausser B, Vasile A, Murakawa Y,
            Schueler M, Youngs N, Penfold-Brown D, Drew K, Milek M, Wyler E,
            Bonneau R, Selbach M, Dieterich C and Landthaler M.
  TITLE     The mRNA-bound proteome and its global occupancy profile on
            protein-coding transcripts
  JOURNAL   Mol. Cell 46 (5), 674-690 (2012)
   PUBMED   22681889
REFERENCE   3  (bases 1 to 3357)
  AUTHORS   Castello A, Fischer B, Eichelbaum K, Horos R, Beckmann BM, Strein
            C, Davey NE, Humphreys DT, Preiss T, Steinmetz LM, Krijgsveld J and
            Hentze MW.
  TITLE     Insights into RNA biology from an atlas of mammalian mRNA-binding
            proteins
  JOURNAL   Cell 149 (6), 1393-1406 (2012)
   PUBMED   22658674
REFERENCE   4  (bases 1 to 3357)
  AUTHORS   Bailey SD, Xie C, Do R, Montpetit A, Diaz R, Mohan V, Keavney B,
            Yusuf S, Gerstein HC, Engert JC and Anand S.
  CONSRTM   DREAM investigators
  TITLE     Variation at the NFATC2 locus increases the risk of
            thiazolidinedione-induced edema in the Diabetes REduction
            Assessment with ramipril and rosiglitazone Medication (DREAM) study
  JOURNAL   Diabetes Care 33 (10), 2250-2253 (2010)
   PUBMED   20628086
  REMARK    GeneRIF: Observational study of gene-disease association,
            gene-environment interaction, and pharmacogenomic / toxicogenomic.
            (HuGE Navigator)
REFERENCE   5  (bases 1 to 3357)
  AUTHORS   Ghosh D, Lippert D, Krokhin O, Cortens JP and Wilkins JA.
  TITLE     Defining the membrane proteome of NK cells
  JOURNAL   J Mass Spectrom 45 (1), 1-25 (2010)
   PUBMED   19946888
REFERENCE   6  (bases 1 to 3357)
  AUTHORS   Andersen JS, Lyon CE, Fox AH, Leung AK, Lam YW, Steen H, Mann M and
            Lamond AI.
  TITLE     Directed proteomic analysis of the human nucleolus
  JOURNAL   Curr. Biol. 12 (1), 1-11 (2002)
   PUBMED   11790298
REFERENCE   7  (bases 1 to 3357)
  AUTHORS   Chan HY, Brogna S and O'Kane CJ.
  TITLE     Dribble, the Drosophila KRR1p homologue, is involved in rRNA
            processing
  JOURNAL   Mol. Biol. Cell 12 (5), 1409-1419 (2001)
   PUBMED   11359931
REFERENCE   8  (bases 1 to 3357)
  AUTHORS   Sasaki T, Toh-E A and Kikuchi Y.
  TITLE     Yeast Krr1p physically and functionally interacts with a novel
            essential Kri1p, and both proteins are required for 40S ribosome
            biogenesis in the nucleolus
  JOURNAL   Mol. Cell. Biol. 20 (21), 7971-7979 (2000)
   PUBMED   11027267
REFERENCE   9  (bases 1 to 3357)
  AUTHORS   Gromadka R, Kaniak A, Slonimski PP and Rytka J.
  TITLE     A novel cross-phylum family of proteins comprises a KRR1 (YCL059c)
            gene which is essential for viability of Saccharomyces cerevisiae
            cells
  JOURNAL   Gene 171 (1), 27-32 (1996)
   PUBMED   8675026
REFERENCE   10 (bases 1 to 3357)
  AUTHORS   Epplen C and Epplen JT.
  TITLE     Expression of (cac)n/(gtg)n simple repetitive sequences in mRNA of
            human lymphocytes
  JOURNAL   Hum. Genet. 93 (1), 35-41 (1994)
   PUBMED   7505766
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BM839950.1, BC005225.1 and AC121761.4.
            On Nov 10, 2006 this sequence version replaced gi:37059784.
           
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
           
            ##Evidence-Data-START##
            Transcript exon combination :: BC033887.2, BC026107.2 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           SAMEA1965299, SAMEA1966682
                                           [ECO:0000350]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-5                 BM839950.1         1-5
            6-1098              BC005225.1         1-1093
            1099-3357           AC121761.4         167790-170048       c
FEATURES             Location/Qualifiers
     source          1..3357
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="12"
                     /map="12q21.2"
     gene            1..3357
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /note="KRR1, small subunit processome component homolog"
                     /db_xref="GeneID:11103"
                     /db_xref="HGNC:HGNC:5176"
                     /db_xref="MIM:612817"
     exon            1..126
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /inference="alignment:Splign:1.39.8"
     CDS             42..1187
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /note="Rev interacting protein; rev-interacting protein 1;
                     HIV-1 Rev-binding protein 2; KRR-R motif-containing
                     protein 1; KRR1, small subunit (SSU) processome component,
                     homolog; HIV-1 rev binding protein 2"
                     /codon_start=1
                     /product="KRR1 small subunit processome component homolog"
                     /protein_id="NP_008974.5"
                     /db_xref="CCDS:CCDS9012.1"
                     /db_xref="GeneID:11103"
                     /db_xref="HGNC:HGNC:5176"
                     /db_xref="MIM:612817"
                     /translation="MASPSLERPEKGAGKSEFRNQKPKPENQDESELLTVPDGWKEPA
                     FSKEDNPRGLLEESSFATLFPKYREAYLKECWPLVQKALNEHHVNATLDLIEGSMTVC
                     TTKKTFDPYIIIRARDLIKLLARSVSFEQAVRILQDDVACDIIKIGSLVRNKERFVKR
                     RQRLIGPKGSTLKALELLTNCYIMVQGNTVSAIGPFSGLKEVRKVVLDTMKNIHPIYN
                     IKSLMIKRELAKDSELRSQSWERFLPQFKHKNVNKRKEPKKKTVKKEYTPFPPPQPES
                     QIDKELASGEYFLKANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKE
                     ASTETKIDVASIKEKVKKAKNKKLGALTAEEIALKMEADEKKKKKKK"
     misc_feature    45..47
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="N-acetylalanine. {ECO:0000244|PubMed:19413330,
                     ECO:0000244|PubMed:20068231, ECO:0000244|PubMed:21406692,
                     ECO:0000269|Ref.6}; propagated from UniProtKB/Swiss-Prot
                     (Q13601.4); acetylation site"
     misc_feature    48..50
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine. {ECO:0000244|PubMed:20068231,
                     ECO:0000244|PubMed:21406692, ECO:0000244|PubMed:23186163};
                     propagated from UniProtKB/Swiss-Prot (Q13601.4);
                     phosphorylation site"
     misc_feature    54..56
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine. {ECO:0000244|PubMed:23186163};
                     propagated from UniProtKB/Swiss-Prot (Q13601.4);
                     phosphorylation site"
     exon            127..299
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /inference="alignment:Splign:1.39.8"
     exon            300..434
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /inference="alignment:Splign:1.39.8"
     exon            435..560
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /inference="alignment:Splign:1.39.8"
     STS             450..611
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /standard_name="KRR1"
                     /db_xref="UniSTS:506336"
     exon            561..644
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /inference="alignment:Splign:1.39.8"
     exon            645..701
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /inference="alignment:Splign:1.39.8"
     exon            702..872
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /inference="alignment:Splign:1.39.8"
     STS             872..1021
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /standard_name="SGC32697"
                     /db_xref="UniSTS:45678"
     exon            873..950
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /inference="alignment:Splign:1.39.8"
     STS             884..1020
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /standard_name="29485"
     STS             948..1077
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /standard_name="RH47132"
                     /db_xref="UniSTS:4654"
     exon            951..1044
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /inference="alignment:Splign:1.39.8"
     exon            1045..3357
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /inference="alignment:Splign:1.39.8"
     STS             1299..1485
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /standard_name="RH46985"
                     /db_xref="UniSTS:67458"
     STS             1461..1724
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /standard_name="RH18004"
                     /db_xref="UniSTS:70991"
     STS             2338..2474
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /standard_name="STS-H56474"
                     /db_xref="UniSTS:29485"
ORIGIN     
        1 agaacagttt catttccgga gccaccggaa gcagcttgca aatggcgtct ccctcgctgg
       61 agcggccaga aaaaggcgct ggaaaaagtg aatttcgtaa ccagaagccg aagccggaga
      121 accaagatga atcagaactc cttacggttc ctgatggttg gaaggaacca gctttttcca
      181 aagaggacaa tcccagagga cttttggagg agagcagttt cgcaactttg ttcccaaaat
      241 acagggaagc ttacttgaaa gagtgttggc cattggtgca gaaagcctta aatgaacatc
      301 atgttaatgc aaccctggac ctgatcgaag gcagcatgac tgtttgtact acaaagaaga
      361 cttttgatcc atatatcatc attagggcca gagatctgat aaaactgtta gcaaggagtg
      421 tttcatttga acaggcagta cgaattcttc aggatgatgt tgcatgtgac atcattaaaa
      481 taggttcttt agtaaggaat aaagagagat ttgtaaaacg aagacaacgg cttattggtc
      541 ccaaaggatc tacattgaag gcattggaac tcttaactaa ttgttacatt atggttcagg
      601 gaaacacagt ttcagccatt ggacctttta gtggcttaaa agaggttaga aaagtagtcc
      661 ttgatactat gaagaatatt catccaattt ataacattaa aagcttaatg attaagagag
      721 agttggcaaa agattctgaa ttacgatcac aaagttggga gagatttttg ccacagttca
      781 aacacaaaaa tgtgaataaa cgcaaggaac caaagaaaaa aactgttaag aaagaatata
      841 cgccattccc accaccacaa ccagaaagtc agatcgataa agaattggct agtggtgaat
      901 actttttgaa ggcaaatcag aagaagcggc agaaaatgga agcaataaag gctaaacaag
      961 cagaagccat cagtaagaga caagaggaaa gaaacaaagc atttattcca cctaaggaaa
     1021 aaccaattgt gaaacctaag gaagcttcta ctgaaactaa aattgatgtg gccagcatca
     1081 aggaaaaggt taagaaagca aagaataaga aactgggagc tcttacagct gaagaaattg
     1141 cacttaagat ggaggcagat gaaaagaaaa agaagaaaaa aaagtaacat acccaaaact
     1201 ccttgactag aactatctcc ttttgtaaag gattttgaga tatcaggcat tagttgcctt
     1261 atttgtgaga aattttctga gggctttttt tttttttggt ggtggtggtt gttcatagaa
     1321 gagtgttctt tataaattat attattattg tattttttga aaaatttata cgagaaagtg
     1381 gtatataagt ctttgtatac attacgacca ttgtgattat ccattaaatc cagtgtctga
     1441 tgctattggt tagtaatgat gtcccagcat ttgatgttcc ctctctaatg ataacaagta
     1501 aatatttagg tttatccctt ttgaaagttt ggttttactt ttaacagtcc atgaacagaa
     1561 aattaaggcc tctaaaatca gatcccctag ttactcctct gttctgaatc tggggaagta
     1621 gtaaaccaaa aagacaggga aaaccagata tttagagtcg aagcagcatg caaaaaataa
     1681 taatgttttt aactaatgaa ggctactgga gttactaaga atcacctaaa aatgtgctac
     1741 tgtaccttgc tcattttgca gatttagaag ctgaaacatg ggttaggtta cttactaaaa
     1801 gtccacctgt ggcaacctgc aaataatgct tatttatact aaagatgagt ttatctgata
     1861 gagttaggaa atttcttctt ttgagtaaga gtattgctat aacatatatt tttttctgaa
     1921 atgttttaaa atagaagtac acctaattgt tattggttaa aaaaaaagcc atatgtgaat
     1981 gaggttggtt tttgggtttt ttctttcctg aattgtatta gtccaaaaga actaaattag
     2041 ggtacttgtg ctgtaccaaa atggtaatta taacagacag tattagaatt actgaattaa
     2101 caatgagaaa gagagaagtg tatctgttac gtggatatat gggccagcct ggatatacaa
     2161 cagagtagta acctgtgaaa caaacataga atatcctctt agacattgtt cctcataatg
     2221 cactgacaga attcacatag ctcttaatga aacaatttaa gattgatgta cgtacgtttg
     2281 acttggtctc gctgtcggtt aactgtaaag ttagggggaa gaaagaaaaa aaattaaaag
     2341 ggtagacaca gttgagagtt ttattttaaa aagctaagtc ttataattat gaccattaac
     2401 ttgctttggc tttattgcag tgactttcca agtttaatta ttcaaaactt tttgaactga
     2461 ctgaattaac ttggtatttt taagttgact ttttacataa actttataaa ccttttataa
     2521 aaaggaaact ataccattac tataaatgga aaatcatttt acacatcata cctagcaggt
     2581 aataaaattt aaaaaataaa aattaaatat tagaatgtga gaaatttatt aaaatatagt
     2641 tctaaaaata agtttcttcc tgagaagaat gatactgttt atgatgaatc catagtgaaa
     2701 agacagtgac ctctctttca tccagtctag tatatcacta aatcatcatt acgatgtttg
     2761 gctatcaagt cattaattac tgtcctcctt tcactgagct ttattcaaat tttgacaatc
     2821 agagcactgg gaagaaataa attccacaac tgcctttagc cttctggata ctttctttta
     2881 taaaatagaa accttttcca caccagttct gcagcagtcg ctattagatg ctcgtggtag
     2941 aacccatcaa tcatctggtc ctctgggtac tggtgagcat ccctggtctt catacctgtg
     3001 agtgggcttt gtggtgaatt actgtaaata tgctaccctc acttttcttg gcagttatgt
     3061 cgatgaaatc aagagtgtga tgttctagtt attttttttt atatatattt ttaaatgttc
     3121 aatattcaac tattgaaaca aatgtacatc tgtgaactag ctaaaatcat cttatgtacc
     3181 actaatatgc ccagcacatt ttgtaaaaca gtcctgattt ggcctccaag ggtatttatt
     3241 gaactaccag cagtatctag gagaccacga aggaatacca cgaaggaatt tatgctccag
     3301 tgcttgccat aatttgtctg agaaggaatc tgttaaataa aagcttttat cctctaa
//

Композиционный код:

1,4,3,1,4,4,1,4,2,3,3,1,3,2,3,3,3,3,3,1,1,1,4,1,4,1,1,3,3,3,2,3,1,3,4,3,3,3,3,1,1,3,2,3,3,1,3,1,1,3,1,3,2,3,1,1,1,
1,3,1,2,3,1,1,2,3,1,1,3,3,1,1,3,1,3,1,2,1,4,1,3,1,3,3,3,3,3,3,3,2,1,4,1,4,1,3,1,1,1,3,3,3,3,2,1,1,3,3,3,2,3,1,1,3,
1,1,3,3,4,2,3,4,3,2,1,3,3,2,3,3,1,2,2,2,3,3,1,3,3,3,2,3,1,1,3,3,2,3,3,3,2,1,3,3,1,3,3,2,3,2,3,3,4,3,3,3,1,3,2,3,2,
1,1,2,1,3,1,3,3,3,3,1,3,1,3,1,2,1,2,3,2,1,3,2,3,3,3,1,3,3,1,3,3,3,2,1,3,3,3,1,1,3,3,3,2,3,3,1,3,3,1,3,1,3,1,3,1,1,
2,3,3,3,3,3,2,2,3,3,1,1,3,3,1,2,1,1,3,1,3,3,4,3,3,1,1,3,2,1,3,3,3,3,1,3,3,3,4,2,1,2,2,2,3,2,3,3,1,1,3,3,3,1,3,3,3,
3,1,3,1,1,2,3,1,1,1,4,1,3,1,3,2,2,1,3,3,3,2,3,1,1,3,1,3,3,1,3,3,1,3,2,3,3,2,3,1,3,3,2,3,4,3,3,1,3,3,3,3,3,3,3,3,3,
4,1,1,1,1,3,1,3,1,3,2,1,3,1,3,4,2,3,3,2,3,3,3,3,2,3,1,1,1,2,3,3,1,3,1,1,3,3,1


Вторичная структура (Пикотех):

https://img-fotki.yandex.ru/get/45704/1 … d_orig.gif

https://img-fotki.yandex.ru/get/106972/158289418.3be/0_17013e_3a317ba0_orig.png
Вот такой лизиновый "хвост"...

345

Re: Формы, механизмы, энергия наномира - 84

https://www.ncbi.nlm.nih.gov/protein/57 … CR2ZZS6015

https://www.ncbi.nlm.nih.gov/nuccore/207113158

Homo sapiens treacle ribosome biogenesis factor 1 (TCOF1), transcript variant 2, mRNA
NCBI Reference Sequence: NM_000356.3
FASTA Graphics
Go to:
LOCUS       NM_000356               4882 bp    mRNA    linear   PRI 15-OCT-2016
DEFINITION  Homo sapiens treacle ribosome biogenesis factor 1 (TCOF1),
            transcript variant 2, mRNA.
ACCESSION   NM_000356
VERSION     NM_000356.3
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 4882)
  AUTHORS   Ciccia A, Huang JW, Izhar L, Sowa ME, Harper JW and Elledge SJ.
  TITLE     Treacher Collins syndrome TCOF1 protein cooperates with NBS1 in the
            DNA damage response
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 111 (52), 18631-18636 (2014)
   PUBMED   25512513
  REMARK    GeneRIF: findings identify TCOF1 as a DDR factor that could
            cooperate with ATM and NBS1 to suppress inappropriate rDNA
            transcription and maintain genomic integrity after DNA damage.
REFERENCE   2  (bases 1 to 4882)
  AUTHORS   Larsen DH, Hari F, Clapperton JA, Gwerder M, Gutsche K, Altmeyer M,
            Jungmichel S, Toledo LI, Fink D, Rask MB, Grofte M, Lukas C,
            Nielsen ML, Smerdon SJ, Lukas J and Stucki M.
  TITLE     The NBS1-Treacle complex controls ribosomal RNA transcription in
            response to DNA damage
  JOURNAL   Nat. Cell Biol. 16 (8), 792-803 (2014)
   PUBMED   25064736
  REMARK    GeneRIF: Treacle-mediated NBS1 recruitment into the nucleoli
            regulates rRNA silencing in trans in the presence of distant
            chromosome breaks.
REFERENCE   3  (bases 1 to 4882)
  AUTHORS   Kadakia S, Helman SN, Badhey AK, Saman M and Ducic Y.
  TITLE     Treacher Collins Syndrome: the genetics of a craniofacial disease
  JOURNAL   Int. J. Pediatr. Otorhinolaryngol. 78 (6), 893-898 (2014)
   PUBMED   24690222
  REMARK    GeneRIF: Mutations in TCOF1, POLR1C and POLR1D have all been
            implicated in causing TCS
            Review article
REFERENCE   4  (bases 1 to 4882)
  AUTHORS   Valdez BC, Henning D, So RB, Dixon J and Dixon MJ.
  TITLE     The Treacher Collins syndrome (TCOF1) gene product is involved in
            ribosomal DNA gene transcription by interacting with upstream
            binding factor
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (29), 10709-10714 (2004)
   PUBMED   15249688
  REMARK    GeneRIF: Results show that treacle is involved in ribosomal DNA
            gene transcription by interacting with upstream binding factor
            (UBF).
REFERENCE   5  (bases 1 to 4882)
  AUTHORS   Dixon J, Edwards SJ, Anderson I, Brass A, Scambler PJ and Dixon MJ.
  TITLE     Identification of the complete coding sequence and genomic
            organization of the Treacher Collins syndrome gene
  JOURNAL   Genome Res. 7 (3), 223-234 (1997)
   PUBMED   9074926
REFERENCE   6  (bases 1 to 4882)
  AUTHORS   Edwards SJ, Gladwin AJ and Dixon MJ.
  TITLE     The mutational spectrum in Treacher Collins syndrome reveals a
            predominance of mutations that create a premature-termination codon
  JOURNAL   Am. J. Hum. Genet. 60 (3), 515-524 (1997)
   PUBMED   9042910
REFERENCE   7  (bases 1 to 4882)
  AUTHORS   Dixon MJ, Dixon J, Houseal T, Bhatt M, Ward DC, Klinger K and
            Landes GM.
  TITLE     Narrowing the position of the Treacher Collins syndrome locus to a
            small interval between three new microsatellite markers at
            5q32-33.1
  JOURNAL   Am. J. Hum. Genet. 52 (5), 907-914 (1993)
   PUBMED   8488840
REFERENCE   8  (bases 1 to 4882)
  AUTHORS   Katsanis,S.H. and Jabs,E.W.
  TITLE     Treacher Collins Syndrome
  JOURNAL   (in) Pagon RA, Adam MP, Ardinger HH, Wallace SE, Amemiya A, Bean
            LJH, Bird TD, Fong CT, Mefford HC, Smith RJH and Stephens K (Eds.);
            GENEREVIEWS(R);
            (1993)
   PUBMED   20301704
REFERENCE   9  (bases 1 to 4882)
  AUTHORS   Dixon MJ, Dixon J, Raskova D, Le Beau MM, Williamson R, Klinger K
            and Landes GM.
  TITLE     Genetic and physical mapping of the Treacher Collins syndrome
            locus: refinement of the localization to chromosome 5q32-33.2
  JOURNAL   Hum. Mol. Genet. 1 (4), 249-253 (1992)
   PUBMED   1303194
REFERENCE   10 (bases 1 to 4882)
  AUTHORS   Jabs EW, Li X, Coss CA, Taylor EW, Meyers DA and Weber JL.
  TITLE     Mapping the Treacher Collins syndrome locus to 5q31.3----q33.3
  JOURNAL   Genomics 11 (1), 193-198 (1991)
   PUBMED   1765376
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from DC377932.1, AC011372.7,
            U76366.1, BC016144.1 and BM664489.1.
            This sequence is a reference standard in the RefSeqGene project.
            On Sep 30, 2008 this sequence version replaced gi:57164974.
           
            Summary: This gene encodes a nucleolar protein with a LIS1 homology
            domain. The protein is involved in ribosomal DNA gene transcription
            through its interaction with upstream binding factor (UBF).
            Mutations in this gene have been associated with Treacher Collins
            syndrome, a disorder which includes abnormal craniofacial
            development. Multiple transcript variants encoding different
            isoforms have been found for this gene. [provided by RefSeq, Sep
            2008].
           
            Transcript Variant: This variant (2) lacks the alternate in-frame
            exon 7, also known as VIa, in the 5' coding region, compared to
            variant 4. The resulting isoform (b) lacks an internal segment but
            has the same N- and C-termini, compared to isoform d.
           
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
           
            ##Evidence-Data-START##
            Transcript exon combination :: U76366.1, U40847.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA1965299, SAMEA1966682
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-19                DC377932.1         1-19
            20-33               AC011372.7         139290-139303
            34-1337             U76366.1           1-1304
            1338-2910           BC016144.1         1489-3061
            2911-3554           U76366.1           2878-3521
            3555-3555           BC016144.1         3592-3592
            3556-4849           U76366.1           3523-4816
            4850-4882           BM664489.1         1-33                c
FEATURES             Location/Qualifiers
     source          1..4882
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="5"
                     /map="5q32-q33.1"
     gene            1..4882
                     /gene="TCOF1"
                     /gene_synonym="MFD1; TCS; TCS1; treacle"
                     /note="treacle ribosome biogenesis factor 1"
                     /db_xref="GeneID:6949"
                     /db_xref="HGNC:HGNC:11654"
                     /db_xref="MIM:606847"
     exon            1..216
                     /gene="TCOF1"
                     /gene_synonym="MFD1; TCS; TCS1; treacle"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    34..36
                     /gene="TCOF1"
                     /gene_synonym="MFD1; TCS; TCS1; treacle"
                     /note="upstream in-frame stop codon"
     CDS             109..4344
                     /gene="TCOF1"
                     /gene_synonym="MFD1; TCS; TCS1; treacle"
                     /note="isoform b is encoded by transcript variant 2;
                     Treacher Collins syndrome protein; nucleolar trafficking
                     phosphoprotein; Treacher Collins-Franceschetti syndrome 1"
                     /codon_start=1
                     /product="treacle protein isoform b"
                     /protein_id="NP_000347.2"
                     /db_xref="CCDS:CCDS4306.1"
                     /db_xref="GeneID:6949"
                     /db_xref="HGNC:HGNC:11654"
                     /db_xref="MIM:606847"
                     /translation="MAEARKRRELLPLIYHHLLRAGYVRAAREVKEQSGQKCFLAQPV
                     TLLDIYTHWQQTSELGRKRKAEEDAALQAKKTRVSDPISTSESSEEEEEAEAETAKAT
                     PRLASTNSSVLGADLPSSMKEKAKAETEKAGKTGNSMPHPATGKTVANLLSGKSPRKS
                     AEPSANTTLVSETEEEGSVPAFGAAAKPGMVSAGQADSSSEDTSSSSDETDVEVKASE
                     KILQVRAASAPAKGTPGKGATPAPPGKAGAVASQTKAGKPEEDSESSSEESSDSEEET
                     PAAKALLQAKASGKTSQVGAASAPAKESPRKGAAPAPPGKTGPAVAKAQAGKREEDSQ
                     SSSEESDSEEEAPAQAKPSGKAPQVRAASAPAKESPRKGAAPAPPRKTGPAAAQVQVG
                     KQEEDSRSSSEESDSDREALAAMNAAQVKPLGKSPQVKPASTMGMGPLGKGAGPVPPG
                     KVGPATPSAQVGKWEEDSESSSEESSDSSDGEVPTAVAPAQEKSLGNILQAKPTSSPA
                     KGPPQKAGPVAVQVKAEKPMDNSESSEESSDSADSEEAPAAMTAAQAKPALKIPQTKA
                     CPKKTNTTASAKVAPVRVGTQAPRKAGTATSPAGSSPAVAGGTQRPAEDSSSSEESDS
                     EEEKTGLAVTVGQAKSVGKGLQVKAASVPVKGSLGQGTAPVLPGKTGPTVTQVKAEKQ
                     EDSESSEEESDSEEAAASPAQVKTSVKKTQAKANPAAARAPSAKGTISAPGKVVTAAA
                     QAKQRSPSKVKPPVRNPQNSTVLARGPASVPSVGKAVATAAQAQTGPEEDSGSSEEES
                     DSEEEAETLAQVKPSGKTHQIRAALAPAKESPRKGAAPTPPGKTGPSAAQAGKQDDSG
                     SSSEESDSDGEAPAAVTSAQVIKPPLIFVDPNRSPAGPAATPAQAQAASTPRKARASE
                     STARSSSSESEDEDVIPATQCLTPGIRTNVVTMPTAHPRIAPKASMAGASSSKESSRI
                     SDGKKQEGPATQVSKKNPASLPLTQAALKVLAQKASEAQPPVARTQPSSGVDSAVGTL
                     PATSPQSTSVQAKGTNKLRKPKLPEVQQATKAPESSDDSEDSSDSSSGSEEDGEGPQG
                     AKSAHTLGPTPSRTETLVEETAAESSEDDVVAPSQSLLSGYMTPGLTPANSQASKATP
                     KLDSSPSVSSTLAAKDDPDGKQEAKPQQAAGMLSPKTGGKEAASGTTPQKSRKPKKGA
                     GNPQASTLALQSNITQCLLGQPWPLNEAQVQASVVKVLTELLEQERKKVVDTTKESSR
                     KGWESRKRKLSGDQPAARTPRSKKKKKLGAGEGGEASVSPEKTSTTSKGKAKRDKASG
                     DVKEKKGKGSLGSQGAKDEPEEELQKGMGTVEGGDQSNPKSKKEKKKSDKRKKDKEKK
                     EKKKKAKKASTKDSESPSQKKKKKKKKTAEQTV"
     exon            217..272
                     /gene="TCOF1"
                     /gene_synonym="MFD1; TCS; TCS1; treacle"
                     /inference="alignment:Splign:1.39.8"
     exon            273..412
                     /gene="TCOF1"
                     /gene_synonym="MFD1; TCS; TCS1; treacle"
                     /inference="alignment:Splign:1.39.8"
     exon            413..486
                     /gene="TCOF1"
                     /gene_synonym="MFD1; TCS; TCS1; treacle"
                     /inference="alignment:Splign:1.39.8"
     exon            487..673
                     /gene="TCOF1"
                     /gene_synonym="MFD1; TCS; TCS1; treacle"
                     /inference="alignment:Splign:1.39.8"
     exon            674..747
                     /gene="TCOF1"
                     /gene_synonym="MFD1; TCS; TCS1; treacle"
                     /inference="alignment:Splign:1.39.8"
     exon            748..960
                     /gene="TCOF1"
                     /gene_synonym="MFD1; TCS; TCS1; treacle"
                     /inference="alignment:Splign:1.39.8"
     exon            961..1155
                     /gene="TCOF1"
                     /gene_synonym="MFD1; TCS; TCS1; treacle"
                     /inference="alignment:Splign:1.39.8"
     exon            1156..1365
                     /gene="TCOF1"
                     /gene_synonym="MFD1; TCS; TCS1; treacle"
                     /inference="alignment:Splign:1.39.8"
     exon            1366..1581
                     /gene="TCOF1"
                     /gene_synonym="MFD1; TCS; TCS1; treacle"
                     /inference="alignment:Splign:1.39.8"
     exon            1582..1770
                     /gene="TCOF1"
                     /gene_synonym="MFD1; TCS; TCS1; treacle"
                     /inference="alignment:Splign:1.39.8"
     exon            1771..2019
                     /gene="TCOF1"
                     /gene_synonym="MFD1; TCS; TCS1; treacle"
                     /inference="alignment:Splign:1.39.8"
     exon            2020..2217
                     /gene="TCOF1"
                     /gene_synonym="MFD1; TCS; TCS1; treacle"
                     /inference="alignment:Splign:1.39.8"
     exon            2218..2355
                     /gene="TCOF1"
                     /gene_synonym="MFD1; TCS; TCS1; treacle"
                     /inference="alignment:Splign:1.39.8"
     exon            2356..2535
                     /gene="TCOF1"
                     /gene_synonym="MFD1; TCS; TCS1; treacle"
                     /inference="alignment:Splign:1.39.8"
     exon            2536..2736
                     /gene="TCOF1"
                     /gene_synonym="MFD1; TCS; TCS1; treacle"
                     /inference="alignment:Splign:1.39.8"
     exon            2737..2923
                     /gene="TCOF1"
                     /gene_synonym="MFD1; TCS; TCS1; treacle"
                     /inference="alignment:Splign:1.39.8"
     exon            2924..3060
                     /gene="TCOF1"
                     /gene_synonym="MFD1; TCS; TCS1; treacle"
                     /inference="alignment:Splign:1.39.8"
     exon            3061..3174
                     /gene="TCOF1"
                     /gene_synonym="MFD1; TCS; TCS1; treacle"
                     /inference="alignment:Splign:1.39.8"
     exon            3175..3394
                     /gene="TCOF1"
                     /gene_synonym="MFD1; TCS; TCS1; treacle"
                     /inference="alignment:Splign:1.39.8"
     exon            3395..3477
                     /gene="TCOF1"
                     /gene_synonym="MFD1; TCS; TCS1; treacle"
                     /inference="alignment:Splign:1.39.8"
     exon            3478..3658
                     /gene="TCOF1"
                     /gene_synonym="MFD1; TCS; TCS1; treacle"
                     /inference="alignment:Splign:1.39.8"
     exon            3659..4219
                     /gene="TCOF1"
                     /gene_synonym="MFD1; TCS; TCS1; treacle"
                     /inference="alignment:Splign:1.39.8"
     STS             3856..3935
                     /gene="TCOF1"
                     /gene_synonym="MFD1; TCS; TCS1; treacle"
                     /standard_name="PMC20330P22"
                     /db_xref="UniSTS:271916"
     STS             4056..4174
                     /gene="TCOF1"
                     /gene_synonym="MFD1; TCS; TCS1; treacle"
                     /standard_name="D5S2276E"
                     /db_xref="UniSTS:154482"
     exon            4220..4317
                     /gene="TCOF1"
                     /gene_synonym="MFD1; TCS; TCS1; treacle"
                     /inference="alignment:Splign:1.39.8"
     exon            4318..4366
                     /gene="TCOF1"
                     /gene_synonym="MFD1; TCS; TCS1; treacle"
                     /inference="alignment:Splign:1.39.8"
     exon            4367..4865
                     /gene="TCOF1"
                     /gene_synonym="MFD1; TCS; TCS1; treacle"
                     /inference="alignment:Splign:1.39.8"
     STS             4416..4548
                     /gene="TCOF1"
                     /gene_synonym="MFD1; TCS; TCS1; treacle"
                     /standard_name="D5S2311E"
                     /db_xref="UniSTS:154519"
     regulatory      4827..4832
                     /regulatory_class="polyA_signal_sequence"
                     /gene="TCOF1"
                     /gene_synonym="MFD1; TCS; TCS1; treacle"
ORIGIN     
        1 gaaagaggag ccggaagtgt ggcgcgcgag gtctaagggc gcgagggaag tggcgggcgg
       61 ggactaaggc ggggcgtgca ggtagccggc cggccggggg tcgcgggtat ggccgaggcc
      121 aggaagcggc gggagctact tcccctgatc taccaccatc tgctgcgggc tggctatgtg
      181 cgtgcggcgc gggaagtgaa ggagcagagc ggccagaagt gtttcctggc tcagcccgta
      241 acccttctgg acatctatac acactggcaa caaacctcag agcttggtcg gaagcggaag
      301 gcagaggaag atgcggcact gcaagctaag aaaacccgtg tgtcagaccc catcagcacc
      361 tcggagagct cggaagagga ggaagaagca gaagccgaaa ccgccaaagc caccccaaga
      421 ctagcatcta ccaactcctc agtcctgggg gcggacttgc catcaagcat gaaagaaaaa
      481 gccaaggcag agacagagaa agctggcaag actgggaatt ccatgccaca ccctgccact
      541 gggaagacgg tggccaacct tctttctggg aagtctccca ggaagtcagc agagccctca
      601 gcaaatacta cgttggtctc agaaactgag gaggagggca gcgtcccggc ctttggagct
      661 gctgccaagc ctgggatggt gtcagcgggc caggccgaca gctccagcga ggacacctcc
      721 agctccagtg atgagacaga cgtggaggta aaggcctctg aaaaaattct ccaggtcaga
      781 gctgcctcag cccctgccaa ggggacccct gggaaagggg ctaccccagc accccctggg
      841 aaggcagggg ctgtagcctc ccagaccaag gcagggaagc cagaggagga ctcagagagc
      901 agcagcgagg agtcatctga cagtgaggag gagacgccag ctgccaaggc cctgcttcag
      961 gcgaaggcct caggaaaaac ctctcaggtc ggagctgcct cagcccctgc caaggagtcc
     1021 cccaggaaag gagctgcccc agcgccccct gggaagacag ggcctgcagt tgccaaggcc
     1081 caggcgggga agcgggagga ggactcgcag agcagcagcg aggaatcgga cagtgaggag
     1141 gaggcgcctg ctcaggcgaa gccttcaggg aaggcccccc aggtcagagc cgcctcggcc
     1201 cctgccaagg agtcccccag gaaaggggct gccccagcac ctcctaggaa aacagggcct
     1261 gcagccgccc aggtccaggt ggggaagcag gaggaggact caagaagcag cagcgaggag
     1321 tcagacagtg acagagaggc actggcagcc atgaatgcag ctcaggtgaa gcccttgggg
     1381 aaaagccccc aggtgaaacc tgcctctacc atgggcatgg ggcccttggg gaaaggcgcc
     1441 ggcccagtgc cacccgggaa ggtggggcct gcaaccccct cagcccaggt ggggaagtgg
     1501 gaggaggact cagagagcag tagtgaggag tcatcagaca gcagtgatgg agaggtgccc
     1561 acagctgtgg ccccggctca ggaaaagtcc ttggggaaca tcctccaggc caaacccacc
     1621 tccagtcctg ccaaggggcc ccctcagaag gcagggcctg tagccgtcca ggtcaaggct
     1681 gaaaagccca tggacaactc ggagagcagc gaggagtcat cggacagtgc ggacagtgag
     1741 gaggcaccag cagccatgac tgcagctcag gcaaaaccag ctctgaaaat tcctcagacc
     1801 aaggcctgcc caaagaaaac caataccact gcatctgcca aggtcgcccc tgtgcgagtg
     1861 ggcacccaag ccccccggaa agcaggaact gcgacttctc cagcaggctc atccccagct
     1921 gtggctgggg gcacccagag accagcagag gattcttcaa gcagtgagga atcagatagt
     1981 gaggaagaga agacaggtct tgcagtaacc gtgggacagg caaagtctgt ggggaaaggc
     2041 ctccaggtga aagcagcctc agtgcctgtc aaggggtcct tggggcaagg gactgctcca
     2101 gtactccctg ggaagacggg gcctacagtc acccaggtga aagctgaaaa gcaggaagac
     2161 tctgagagca gtgaggagga atcagacagt gaggaagcag ctgcatctcc agcacaggtg
     2221 aaaacctcag taaagaaaac ccaggccaaa gccaacccag ctgccgccag agcaccttca
     2281 gcaaaaggga caatttcagc ccctggaaaa gttgtcactg cagctgctca agccaagcag
     2341 aggtctccat ccaaggtgaa gccaccagtg agaaaccccc agaacagtac cgtcttggcg
     2401 aggggcccag catctgtgcc atctgtgggg aaggccgtgg ctacagcagc tcaggcccag
     2461 acagggccag aggaggactc agggagcagt gaggaggagt cagacagtga ggaggaggcg
     2521 gagacgctgg ctcaggtgaa gccttcaggg aagacccacc agatcagagc tgccttggct
     2581 cctgccaagg agtcccccag gaaaggggct gccccaacac ctcctgggaa gacagggcct
     2641 tcggctgccc aggcagggaa gcaggatgac tcagggagca gcagcgagga atcagacagt
     2701 gatggggagg caccggcagc tgtgacctct gcccaggtga ttaaaccccc tctgattttt
     2761 gtcgacccta atcgtagtcc agctggccca gctgctacac ccgcacaagc ccaggctgca
     2821 agcaccccga ggaaggcccg agcctcggag agcacagcca ggagctcctc ctccgagagc
     2881 gaggatgagg acgtgatccc cgctacacag tgcttgactc ctggcatcag aaccaatgtg
     2941 gtgaccatgc ccactgccca cccaagaata gcccccaaag ccagcatggc tggggccagc
     3001 agcagcaagg agtccagtcg gatatcagat ggcaagaaac aggagggacc agccactcag
     3061 gtgtcaaaga agaacccagc ttccctccca ctgacccagg ctgccctgaa ggtcctcgcc
     3121 cagaaagcca gtgaggctca gcctcctgtt gccaggaccc agccttcaag tggggttgac
     3181 agtgctgtgg gaacactccc tgcaacaagt ccccagagca cctccgtcca ggccaaaggg
     3241 accaacaagc tcagaaaacc taagcttcct gaggtccagc aggccaccaa agcccctgag
     3301 agctcagatg acagtgagga cagcagcgac agttcttcag ggagtgagga agatggtgaa
     3361 gggccccagg gggccaagtc agcccacacg ctgggtccca ccccctccag gacagagacc
     3421 ctggtggagg agaccgcagc agagtccagc gaggatgatg tggtggcgcc atcccagtct
     3481 ctcctctcag gttatatgac ccctggacta accccagcca attcccaggc ctcaaaagcc
     3541 actcccaagc tagactccag cccctcagtt tcctctactc tggccgccaa agatgaccca
     3601 gatggcaagc aggaggcaaa gccccaacag gcagcaggca tgttgtcccc taaaacaggt
     3661 ggaaaagagg ctgcttcagg caccacacct cagaagtccc ggaagcccaa gaaaggggct
     3721 gggaaccccc aagcctcaac cctggcgctg caaagcaaca tcacccagtg cctcctgggc
     3781 caaccctggc ccctgaatga ggcccaggtg caggcctcag tggtgaaggt cctgactgag
     3841 ctgctggaac aggaaagaaa gaaggtggtg gacaccacca aggagagcag caggaagggc
     3901 tgggagagcc gcaagcggaa gctatcggga gaccagccag ctgccaggac ccccaggagc
     3961 aagaagaaga agaagctggg ggccggggaa ggtggggagg cctctgtttc cccagaaaag
     4021 acctccacga cttccaaggg gaaagcaaag agagacaaag caagtggtga tgtcaaggag
     4081 aagaaaggga aggggtctct tggctcccaa ggggccaagg acgagccaga agaggagctt
     4141 cagaagggga tggggacggt tgaaggtgga gatcaaagca acccaaagag caagaaggag
     4201 aagaagaaat ccgacaagag aaaaaaagac aaagaaaaaa aagaaaagaa gaagaaagca
     4261 aaaaaggcct caaccaaaga ttctgagtca ccgtcccaga agaaaaagaa gaaaaagaag
     4321 aagacagcag agcagactgt atgacgagca ccagcaccag gcacagggat ttcctagccg
     4381 agcagtggcc atccccatgc ctctgacctc caccgacctc tgcccaccat gggttggaac
     4441 taaactgtta ccttccctcg ctccacagaa gaagacagcc agcttcaggg gtccctgtgc
     4501 tggccaagcc agtgagcctg cggggaggct ggtccaagga gaaagtggac cagctcccat
     4561 gacctcaccc cactccccca acacaggacg cttcatatag atgtgtacag tatatgtatt
     4621 tttttaagtg acctcctctc cttccacaga ccccacatgc ccaaaggcct cgggacttcc
     4681 caccaccttg ctccacagat ccagctaggc ctgacctgtg cctcatcccg tgccgctcgg
     4741 tctctggctg atcccgaggc tttgtcttcc tctcgtcagt tcttttggtt gtgttttttg
     4801 tttttttttt aataactcaa aaaaaaaata aaagacttgg aggaagggtg caagctccca
     4861 gtgcaaaaaa aaaaaaaaaa aa
//

346

Re: Формы, механизмы, энергия наномира - 84

https://www.ncbi.nlm.nih.gov/protein/57 … CR2ZZS6015

https://www.ncbi.nlm.nih.gov/nuccore/207113158

FT CDS 109..4344 
        1 gaaagaggag ccggaagtgt ggcgcgcgag gtctaagggc gcgagggaag tggcgggcgg
       61 ggactaaggc ggggcgtgca ggtagccggc cggccggggg tcgcgggtat ggccgaggcc
      121 aggaagcggc gggagctact tcccctgatc taccaccatc tgctgcgggc tggctatgtg
      181 cgtgcggcgc gggaagtgaa ggagcagagc ggccagaagt gtttcctggc tcagcccgta
      241 acccttctgg acatctatac acactggcaa caaacctcag agcttggtcg gaagcggaag
      301 gcagaggaag atgcggcact gcaagctaag aaaacccgtg tgtcagaccc catcagcacc
      361 tcggagagct cggaagagga ggaagaagca gaagccgaaa ccgccaaagc caccccaaga
      421 ctagcatcta ccaactcctc agtcctgggg gcggacttgc catcaagcat gaaagaaaaa
      481 gccaaggcag agacagagaa agctggcaag actgggaatt ccatgccaca ccctgccact
      541 gggaagacgg tggccaacct tctttctggg aagtctccca ggaagtcagc agagccctca
      601 gcaaatacta cgttggtctc agaaactgag gaggagggca gcgtcccggc ctttggagct
      661 gctgccaagc ctgggatggt gtcagcgggc caggccgaca gctccagcga ggacacctcc
      721 agctccagtg atgagacaga cgtggaggta aaggcctctg aaaaaattct ccaggtcaga
      781 gctgcctcag cccctgccaa ggggacccct gggaaagggg ctaccccagc accccctggg
      841 aaggcagggg ctgtagcctc ccagaccaag gcagggaagc cagaggagga ctcagagagc
      901 agcagcgagg agtcatctga cagtgaggag gagacgccag ctgccaaggc cctgcttcag
      961 gcgaaggcct caggaaaaac ctctcaggtc ggagctgcct cagcccctgc caaggagtcc
     1021 cccaggaaag gagctgcccc agcgccccct gggaagacag ggcctgcagt tgccaaggcc
     1081 caggcgggga agcgggagga ggactcgcag agcagcagcg aggaatcgga cagtgaggag
     1141 gaggcgcctg ctcaggcgaa gccttcaggg aaggcccccc aggtcagagc cgcctcggcc
     1201 cctgccaagg agtcccccag gaaaggggct gccccagcac ctcctaggaa aacagggcct
     1261 gcagccgccc aggtccaggt ggggaagcag gaggaggact caagaagcag cagcgaggag
     1321 tcagacagtg acagagaggc actggcagcc atgaatgcag ctcaggtgaa gcccttgggg
     1381 aaaagccccc aggtgaaacc tgcctctacc atgggcatgg ggcccttggg gaaaggcgcc
     1441 ggcccagtgc cacccgggaa ggtggggcct gcaaccccct cagcccaggt ggggaagtgg
     1501 gaggaggact cagagagcag tagtgaggag tcatcagaca gcagtgatgg agaggtgccc
     1561 acagctgtgg ccccggctca ggaaaagtcc ttggggaaca tcctccaggc caaacccacc
     1621 tccagtcctg ccaaggggcc ccctcagaag gcagggcctg tagccgtcca ggtcaaggct
     1681 gaaaagccca tggacaactc ggagagcagc gaggagtcat cggacagtgc ggacagtgag
     1741 gaggcaccag cagccatgac tgcagctcag gcaaaaccag ctctgaaaat tcctcagacc
     1801 aaggcctgcc caaagaaaac caataccact gcatctgcca aggtcgcccc tgtgcgagtg
     1861 ggcacccaag ccccccggaa agcaggaact gcgacttctc cagcaggctc atccccagct
     1921 gtggctgggg gcacccagag accagcagag gattcttcaa gcagtgagga atcagatagt
     1981 gaggaagaga agacaggtct tgcagtaacc gtgggacagg caaagtctgt ggggaaaggc
     2041 ctccaggtga aagcagcctc agtgcctgtc aaggggtcct tggggcaagg gactgctcca
     2101 gtactccctg ggaagacggg gcctacagtc acccaggtga aagctgaaaa gcaggaagac
     2161 tctgagagca gtgaggagga atcagacagt gaggaagcag ctgcatctcc agcacaggtg
     2221 aaaacctcag taaagaaaac ccaggccaaa gccaacccag ctgccgccag agcaccttca
     2281 gcaaaaggga caatttcagc ccctggaaaa gttgtcactg cagctgctca agccaagcag
     2341 aggtctccat ccaaggtgaa gccaccagtg agaaaccccc agaacagtac cgtcttggcg
     2401 aggggcccag catctgtgcc atctgtgggg aaggccgtgg ctacagcagc tcaggcccag
     2461 acagggccag aggaggactc agggagcagt gaggaggagt cagacagtga ggaggaggcg
     2521 gagacgctgg ctcaggtgaa gccttcaggg aagacccacc agatcagagc tgccttggct
     2581 cctgccaagg agtcccccag gaaaggggct gccccaacac ctcctgggaa gacagggcct
     2641 tcggctgccc aggcagggaa gcaggatgac tcagggagca gcagcgagga atcagacagt
     2701 gatggggagg caccggcagc tgtgacctct gcccaggtga ttaaaccccc tctgattttt
     2761 gtcgacccta atcgtagtcc agctggccca gctgctacac ccgcacaagc ccaggctgca
     2821 agcaccccga ggaaggcccg agcctcggag agcacagcca ggagctcctc ctccgagagc
     2881 gaggatgagg acgtgatccc cgctacacag tgcttgactc ctggcatcag aaccaatgtg
     2941 gtgaccatgc ccactgccca cccaagaata gcccccaaag ccagcatggc tggggccagc
     3001 agcagcaagg agtccagtcg gatatcagat ggcaagaaac aggagggacc agccactcag
     3061 gtgtcaaaga agaacccagc ttccctccca ctgacccagg ctgccctgaa ggtcctcgcc
     3121 cagaaagcca gtgaggctca gcctcctgtt gccaggaccc agccttcaag tggggttgac
     3181 agtgctgtgg gaacactccc tgcaacaagt ccccagagca cctccgtcca ggccaaaggg
     3241 accaacaagc tcagaaaacc taagcttcct gaggtccagc aggccaccaa agcccctgag
     3301 agctcagatg acagtgagga cagcagcgac agttcttcag ggagtgagga agatggtgaa
     3361 gggccccagg gggccaagtc agcccacacg ctgggtccca ccccctccag gacagagacc
     3421 ctggtggagg agaccgcagc agagtccagc gaggatgatg tggtggcgcc atcccagtct
     3481 ctcctctcag gttatatgac ccctggacta accccagcca attcccaggc ctcaaaagcc
     3541 actcccaagc tagactccag cccctcagtt tcctctactc tggccgccaa agatgaccca
     3601 gatggcaagc aggaggcaaa gccccaacag gcagcaggca tgttgtcccc taaaacaggt
     3661 ggaaaagagg ctgcttcagg caccacacct cagaagtccc ggaagcccaa gaaaggggct
     3721 gggaaccccc aagcctcaac cctggcgctg caaagcaaca tcacccagtg cctcctgggc
     3781 caaccctggc ccctgaatga ggcccaggtg caggcctcag tggtgaaggt cctgactgag
     3841 ctgctggaac aggaaagaaa gaaggtggtg gacaccacca aggagagcag caggaagggc
     3901 tgggagagcc gcaagcggaa gctatcggga gaccagccag ctgccaggac ccccaggagc
     3961 aagaagaaga agaagctggg ggccggggaa ggtggggagg cctctgtttc cccagaaaag
     4021 acctccacga cttccaaggg gaaagcaaag agagacaaag caagtggtga tgtcaaggag
     4081 aagaaaggga aggggtctct tggctcccaa ggggccaagg acgagccaga agaggagctt
     4141 cagaagggga tggggacggt tgaaggtgga gatcaaagca acccaaagag caagaaggag
     4201 aagaagaaat ccgacaagag aaaaaaagac aaagaaaaaa aagaaaagaa gaagaaagca
     4261 aaaaaggcct caaccaaaga ttctgagtca ccgtcccaga agaaaaagaa gaaaaagaag
     4321 aagacagcag agcagactgt atgacgagca ccagcaccag gcacagggat ttcctagccg
     4381 agcagtggcc atccccatgc ctctgacctc caccgacctc tgcccaccat gggttggaac
     4441 taaactgtta ccttccctcg ctccacagaa gaagacagcc agcttcaggg gtccctgtgc
     4501 tggccaagcc agtgagcctg cggggaggct ggtccaagga gaaagtggac cagctcccat
     4561 gacctcaccc cactccccca acacaggacg cttcatatag atgtgtacag tatatgtatt
     4621 tttttaagtg acctcctctc cttccacaga ccccacatgc ccaaaggcct cgggacttcc
     4681 caccaccttg ctccacagat ccagctaggc ctgacctgtg cctcatcccg tgccgctcgg
     4741 tctctggctg atcccgaggc tttgtcttcc tctcgtcagt tcttttggtt gtgttttttg
     4801 tttttttttt aataactcaa aaaaaaaata aaagacttgg aggaagggtg caagctccca
     4861 gtgcaaaaaa aaaaaaaaaa aa
//

Композиционный код:

1,1,1,1,1,1,4,4,1,2,3,1,4,1,1,1,3,4,4,4,3,1,3,4,3,4,4,4,3,4,1,1,1,1,1,1,1,3,1,4,3,1,1,2,1,3,4,1,1,3,2,1,1,3,3,1,2,
1,3,3,4,1,4,1,2,1,3,3,4,2,4,3,3,1,3,1,3,4,2,1,1,1,1,1,4,1,1,4,3,1,1,3,3,2,3,1,3,1,1,3,1,1,2,3,2,2,3,1,1,1,2,1,4,4,
4,1,1,2,2,1,1,3,3,3,1,1,2,1,2,1,3,3,1,1,3,4,3,1,1,2,1,3,1,3,4,1,4,4,1,1,3,3,3,4,1,3,1,1,1,2,2,1,1,2,2,3,3,4,1,1,2,
3,3,1,1,1,1,1,1,4,1,3,2,3,3,1,1,3,4,1,4,2,4,1,1,1,1,1,1,1,1,1,1,1,1,1,3,3,1,2,1,4,1,2,1,1,3,3,3,3,1,1,1,3,3,1,2,1,
3,1,1,4,1,3,4,3,4,3,1,2,2,1,3,4,1,2,4,3,2,1,1,1,1,1,2,4,1,2,1,1,1,2,1,1,1,1,1,1,2,3,1,3,1,1,1,4,2,3,1,1,1,4,3,1,4,
1,1,2,2,3,1,3,1,1,2,3,1,2,1,3,1,1,1,1,1,1,3,2,3,1,2,4,1,3,4,1,2,4,3,2,3,1,1,1,1,4,4,1,4,1,1,1,4,1,1,1,1,1,3,4,1,3,
1,1,1,4,3,3,1,4,1,3,2,4,1,1,1,1,1,3,1,1,4,1,3,1,1,1,1,1,1,3,4,3,1,2,2,3,3,1,3,2,4,3,2,1,1,1,1,1,4,4,1,1,1,1,1,2,3,
1,1,1,1,1,2,1,3,1,3,1,2,4,2,1,1,3,2,3,1,4,1,1,1,4,3,1,1,1,4,3,3,1,3,1,1,1,1,4,1,1,4,3,1,1,1,2,4,2,1,4,1,4,4,3,2,1,
1,2,1,1,4,4,1,1,1,1,1,2,1,1,3,3,1,1,2,2,1,1,3,3,2,1,4,1,2,3,4,1,4,3,1,3,1,1,1,4,1,1,1,1,1,3,1,1,1,3,3,1,1,4,1,3,1,
1,2,4,3,2,1,1,1,1,1,3,3,1,1,1,1,1,4,1,1,1,1,1,2,4,1,3,4,1,3,1,1,2,2,2,1,1,3,2,3,1,2,3,2,3,4,3,3,3,1,1,1,1,1,2,1,3,
1,3,1,3,2,3,1,1,1,1,3,4,2,4,1,1,3,1,1,4,3,2,2,3,4,3,3,2,2,1,2,1,2,3,4,3,4,1,1,1,3,2,2,1,3,3,2,1,3,1,3,2,3,3,1,3,1,
1,2,3,3,2,2,1,4,2,1,2,1,3,4,4,3,1,1,1,4,3,2,1,2,4,3,1,1,4,1,1,4,3,4,3,3,2,2,1,3,4,1,4,4,3,2,1,1,1,4,3,3,3,1,1,3,1,
3,1,1,3,1,1,3,2,1,3,1,3,2,3,2,3,2,2,1,4,3,1,2,2,1,3,1,1,1,3,1,1,2,3,1,1,3,2,3,2,2,3,4,2,3,2,1,3,2,3,3,1,3,2,3,3,3,
1,1,1,1,3,2,1,1,4,1,2,2,4,3,1,1,1,1,3,1,1,1,4,1,1,2,2,3,4,2,3,4,4,1,1,4,3,2,2,3,1,1,1,2,4,2,1,1,1,2,4,1,3,1,1,1,2,
1,3,1,1,1,4,1,4,4,3,1,4,1,3,2,4,1,1,1,1,1,3,3,1,1,3,3,1,1,1,1,1,1,3,4,3,1,2,2,3,3,4,1,2,4,3,4,3,1,1,2,4,1,1,3,1,2,
4,1,1,1,1,3,2,1,3,3,4,1,2,4,2,3,4,1,3,1,1,4,3,3,1,3,4,3,3,1,1,3,3,3,3,2,3,1,2,3,3,2,1,2,3,1,1,3,2,1,1,4,1,1,1,2,1,
4,1,1,2,1,1,1,1,1,1,1,1,1,3,1,1,4,1,1,3,2,1,1,1,3,3,1,1,3,1,3,4,4,1,1,1,3,1,1,2,3,2,1,1,3,1,1,1,3,4,1,1,1,1,1,1,1,
3,4,2,2,3,1,1,3,1,1,2,2,1,3,1,4,2,1,1,1,2,3,1,1,2,4,1,1,3,1,4,1,1,1,1,1,3,1,3,1,3,1,3,3,3,1,1,1,1,3,2,3,4,3,1,3,3,
4,2,2,1,3,2,2,3,1,1,1,1,1,1,1,1,3,4,1,1,1,1,3,3,3,1,3,3,1,1,1,1,1,1,3,1,3,1,1,2,3,1,3,1,1,1,1,1,3,3,2,4,3,1,3,3,3,
3,4,1,1,4,1,1,2,1,1,4,4,3,1,1,1,1,1,2,1,1,4,4,1,1,1,2,2,1,1,1,1,3,3,4,4,4,2,1,1,3,1,1,2,3,3,1,1,3,2,2,1,2,1,3,1,1,
1,2,3,1,3,1,1,2,1,1,1,1,2,3,1,3,3,4,1,1,3,3,1,2,3,1,1,1,1,2,1,1,3,1,2,2,1,1,1,1,3,3,2,3,2,3,1,3,3,2,1,1,2,3,1,1,1,
4,1,1,1,3,4,3,4,1,1,3,1,2,1,4,4,4,3,1,1,1,1,1,1,1,4,1,3,1,1,1,4,3,1,1,1,4,1,1,2,4,4,1,1,4,3,1,4,4,3,1,3,3,1,1,4,4,
1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,4,1,2,4,2,1,1,2,3,1,1,1,1,1,1,1,1,1,1,1,4,4,1,4,3,3,4,1,1,3,3,1,2,3,1,1,1,4,3,1,1,4,
3,2,1,3,1,3,2,3,3,3,1,1,1,1,3,4,1,4,3,3,1,1,3,4,1,1,1,1,2,3,1,1,3,1,1,4,1,4,4,3,3,3,2,3,3,1,1,2,1,1,1,1,1,1,1,3,1,
1,1,3,3,3,1,3,3,3,3,3,1,1,1,3,2,3,1,1,2,1,3,3,3,1,2,4,1,1,1,3,1,1,3,1,1,1,2,2,1,1,3,2

Вторичная структура (Пикотех): https://img-fotki.yandex.ru/get/98050/1 … e_orig.gif

https://img-fotki.yandex.ru/get/194492/158289418.3be/0_1701c2_5bb74901_orig.png

347

Re: Формы, механизмы, энергия наномира - 84

http://www.rcsb.org/pdb/explore/explore … ureId=5DFE

http://www.uniprot.org/uniprot/P07012

http://www.ebi.ac.uk/ena/data/view/AAA24520

ID   AAA24520; SV 1; linear; genomic DNA; STD; PRO; 1098 BP.
XX
PA   M11520.1
XX
DT   02-JUL-1986 (Rel. 9, Created)
DT   02-FEB-2005 (Rel. 82, Last updated, Version 5)
XX
DE   Escherichia coli peptide chain release factor 2
XX
KW   .
XX
OS   Escherichia coli
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Escherichia.
XX
RN   [1]
RX   DOI; 10.1073/pnas.82.11.3616.
RX   PUBMED; 3889910.
RA   Craigen W.J., Cook R.G., Tate W.P., Caskey C.T.;
RT   "Bacterial peptide chain release factors: conserved primary structure and
RT   possible frameshift regulation of release factor 2";
RL   Proc. Natl. Acad. Sci. U.S.A. 82(11):3616-3620(1985).
XX
RN   [2]
RX   PUBMED; 3049538.
RA   Lee C.C., Kohara Y., Akiyama K., Smith C.L., Craigen W.J., Caskey C.T.;
RT   "Rapid and precise mapping of the Escherichia coli release factor genes by
RT   two physical approaches";
RL   J. Bacteriol. 170(10):4537-4541(1988).
XX
DR   MD5; b2552eb9ee7bd565239a1fc5fa6ffab7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1098
FT                   /organism="Escherichia coli"
FT                   /strain="RR1"
FT                   /mol_type="genomic DNA"
FT                   /clone="pRF2-1"
FT                   /db_xref="taxon:562"
FT   CDS             join(M11520.1:302..376,M11520.1:378..1400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="peptide chain release factor 2"
FT                   /db_xref="GOA:P07012"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR020853"
FT                   /db_xref="PDB:1GQE"
FT                   /db_xref="PDB:1MI6"
FT                   /db_xref="PDB:1ML5"
FT                   /db_xref="UniProtKB/Swiss-Prot:P07012"
FT                   /protein_id="AAA24520.1"
FT                   /translation="MFEINPVNNRIQDLTERSDVLRGYLDYDAKKERLEEVNAELEQPD
FT                   VWNEPERAQALGKERSSLEAVVDTLDQMKQGLEDVSGLLELAVEADDEETFNEAVAELD
FT                   ALEEKLAQLEFRRMFSGEYDSADCYLDIQAGSGGTEAQDWASMLERMYLRWAESRGFKT
FT                   EIIEESEGEVAGIKSVTIKISGDYAYGWLRTETGVHRVVRKSPFDSGGRRHTSFSSAFV
FT                   YPEVDDDIDIEINPADLRIDVYRTSGAGGQHVNRTESAVRITHIPTGIVTQCQNDRSQH
FT                   KNKDQAMKQMKAKLYELEMQKKNAEKQAMEDNKSDIGWGSQIRSYVLDDSRIKDLRTGV
FT                   ETRNTQAVLDGSLDQFIEASLKAGL"
XX
SQ   Sequence 1098 BP; 287 A; 273 C; 315 G; 223 T; 0 other;
     atgtttgaaa ttaatccggt aaataatcgc attcaggacc tcacggaacg ctccgacgtt        60
     cttagggggt atcttgacta cgacgccaag aaagagcgtc tggaagaagt aaacgccgag       120
     ctggaacagc cggatgtctg gaacgaaccc gaacgcgcac aggcgctggg taaagagcgt       180
     tcctccctcg aagccgttgt cgacaccctc gaccaaatga aacaggggct ggaagatgtt       240
     tctggtctgc tggaactggc tgtagaagct gacgacgaag aaacctttaa cgaagccgtt       300
     gctgaactcg acgccctgga agaaaaactg gcgcagcttg agttccgccg tatgttctct       360
     ggcgaatatg acagcgccga ctgctacctc gatattcagg cggggtctgg cggtacggaa       420
     gcacaggact gggcgagcat gcttgagcgt atgtatctgc gctgggcaga atcgcgtggt       480
     ttcaaaactg aaatcatcga agagtcggaa ggtgaagtgg cgggtattaa atccgtgacg       540
     atcaaaatct ccggcgatta cgcttacggc tggctgcgta cagaaaccgg cgttcaccgc       600
     gtggtgcgta aaagcccgtt tgactccggc ggtcgtcgcc acacgtcgtt cagctccgcg       660
     tttgtttatc cggaagttga tgatgatatt gatatcgaaa tcaacccggc ggatctgcgc       720
     attgacgttt atcgcacgtc cggcgcgggc ggtcagcacg ttaaccgtac cgaatctgcg       780
     gtgcgtatta cccacatccc gaccgggatc gtgacccagt gccagaacga ccgttcccag       840
     cacaagaaca aagatcaggc catgaagcag atgaaagcga agctttatga actggagatg       900
     cagaagaaaa atgccgagaa acaggcgatg gaagataaca aatccgacat cggctggggc       960
     agccagattc gttcttatgt ccttgatgac tcccgcatta aagatctgcg caccggggta      1020
     gaaacccgca acacgcaggc cgtgctggac ggcagcctgg atcaatttat cgaagcaagt      1080
     ttgaaagcag ggttatga                                                    1098
//

>ENA|AAA24520|AAA24520.1 Escherichia coli peptide chain release factor 2
ATGTTTGAAATTAATCCGGTAAATAATCGCATTCAGGACCTCACGGAACGCTCCGACGTT
CTTAGGGGGTATCTTGACTACGACGCCAAGAAAGAGCGTCTGGAAGAAGTAAACGCCGAG
CTGGAACAGCCGGATGTCTGGAACGAACCCGAACGCGCACAGGCGCTGGGTAAAGAGCGT
TCCTCCCTCGAAGCCGTTGTCGACACCCTCGACCAAATGAAACAGGGGCTGGAAGATGTT
TCTGGTCTGCTGGAACTGGCTGTAGAAGCTGACGACGAAGAAACCTTTAACGAAGCCGTT
GCTGAACTCGACGCCCTGGAAGAAAAACTGGCGCAGCTTGAGTTCCGCCGTATGTTCTCT
GGCGAATATGACAGCGCCGACTGCTACCTCGATATTCAGGCGGGGTCTGGCGGTACGGAA
GCACAGGACTGGGCGAGCATGCTTGAGCGTATGTATCTGCGCTGGGCAGAATCGCGTGGT
TTCAAAACTGAAATCATCGAAGAGTCGGAAGGTGAAGTGGCGGGTATTAAATCCGTGACG
ATCAAAATCTCCGGCGATTACGCTTACGGCTGGCTGCGTACAGAAACCGGCGTTCACCGC
GTGGTGCGTAAAAGCCCGTTTGACTCCGGCGGTCGTCGCCACACGTCGTTCAGCTCCGCG
TTTGTTTATCCGGAAGTTGATGATGATATTGATATCGAAATCAACCCGGCGGATCTGCGC
ATTGACGTTTATCGCACGTCCGGCGCGGGCGGTCAGCACGTTAACCGTACCGAATCTGCG
GTGCGTATTACCCACATCCCGACCGGGATCGTGACCCAGTGCCAGAACGACCGTTCCCAG
CACAAGAACAAAGATCAGGCCATGAAGCAGATGAAAGCGAAGCTTTATGAACTGGAGATG
CAGAAGAAAAATGCCGAGAAACAGGCGATGGAAGATAACAAATCCGACATCGGCTGGGGC
AGCCAGATTCGTTCTTATGTCCTTGATGACTCCCGCATTAAAGATCTGCGCACCGGGGTA
GAAACCCGCAACACGCAGGCCGTGCTGGACGGCAGCCTGGATCAATTTATCGAAGCAAGT
TTGAAAGCAGGGTTATGA

Композиционный код:

1,3,3,3,3,4,2,3,3,1,3,1,1,1,4,3,1,1,1,3,3,1,4,3,3,1,1,1,1,1,3,1,3,4,3,3,2,1,1,1,4,3,1,4,3,1,1,1,3,1,3,1,2,1,4,4,3,
3,1,3,1,1,1,3,1,3,1,1,1,1,1,3,1,3,1,4,4,3,3,3,3,3,4,4,3,4,3,2,3,3,1,1,3,3,1,3,1,3,1,3,3,3,1,1,1,4,3,3,3,4,4,1,3,1,
1,1,3,1,1,3,1,3,3,1,1,1,1,1,1,1,3,3,1,4,4,3,1,3,4,3,2,1,1,1,4,1,1,3,1,3,1,3,4,1,1,2,3,4,3,3,1,3,3,3,1,1,3,1,4,3,3,
3,4,4,3,3,3,1,4,4,1,3,1,1,1,3,1,3,1,1,1,4,3,2,3,1,1,3,1,1,4,4,3,3,1,4,3,1,1,1,3,3,1,1,4,4,1,1,1,4,3,3,3,4,3,3,3,3,
3,3,3,1,3,1,1,4,4,3,4,1,3,1,3,3,1,4,1,1,4,1,3,1,1,3,1,3,1,3,3,4,4,3,3,1,1,1,4,1,4,1,4,1,1,1,1,1,1,3,1,1,1,1,1,3,3,
1,1,1,1,1,1,3,4,1,3,3,3,4,1,1,1,1,3,3,1,1,3,1,4,1,3,3,1,3,1,1,1,1,1,1,1,1,3,3,3,3,1,3,3,1,1,1,3,3,3,4,1,1,4,2,3,1,
1,1,4,1,1,4,4,1,1,1,4,3,3,3,1,3,2,3,1,3,2,4,3


Вторичная структура (Пикотех): https://img-fotki.yandex.ru/get/194425/ … d_orig.gif

348

Re: Формы, механизмы, энергия наномира - 84

https://www.ncbi.nlm.nih.gov/protein/11 … CR2ZZS6015

https://www.ncbi.nlm.nih.gov/nuccore/111607440

Homo sapiens lysine rich nucleolar protein 1 (KNOP1), mRNA
NCBI Reference Sequence: NM_001012991.2
FASTA Graphics
Go to:
LOCUS       NM_001012991            1974 bp    mRNA    linear   PRI 25-AUG-2016
DEFINITION  Homo sapiens lysine rich nucleolar protein 1 (KNOP1), mRNA.
ACCESSION   NM_001012991 XM_001126237 XM_001132285
VERSION     NM_001012991.2
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1974)
  AUTHORS   Castello A, Fischer B, Eichelbaum K, Horos R, Beckmann BM, Strein
            C, Davey NE, Humphreys DT, Preiss T, Steinmetz LM, Krijgsveld J and
            Hentze MW.
  TITLE     Insights into RNA biology from an atlas of mammalian mRNA-binding
            proteins
  JOURNAL   Cell 149 (6), 1393-1406 (2012)
   PUBMED   22658674
REFERENCE   2  (bases 1 to 1974)
  AUTHORS   Loftus BJ, Kim UJ, Sneddon VP, Kalush F, Brandon R, Fuhrmann J,
            Mason T, Crosby ML, Barnstead M, Cronin L, Deslattes Mays A, Cao Y,
            Xu RX, Kang HL, Mitchell S, Eichler EE, Harris PC, Venter JC and
            Adams MD.
  TITLE     Genome duplications and other features in 12 Mb of DNA sequence
            from human chromosome 16p and 16q
  JOURNAL   Genomics 60 (3), 295-308 (1999)
   PUBMED   10493829
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC117562.1.
            On or before Sep 20, 2006 this sequence version replaced
            gi:113426006, gi:113426340, gi:61175269.
           
            ##Evidence-Data-START##
            Transcript exon combination :: BC117562.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA1965299, SAMEA1966682
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1974
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="16"
                     /map="16p12.3"
     gene            1..1974
                     /gene="KNOP1"
                     /gene_synonym="101F10.1; C16orf88; FAM191A; TSG118"
                     /note="lysine rich nucleolar protein 1"
                     /db_xref="GeneID:400506"
                     /db_xref="HGNC:HGNC:34404"
     exon            1..13
                     /gene="KNOP1"
                     /gene_synonym="101F10.1; C16orf88; FAM191A; TSG118"
                     /inference="alignment:Splign:1.39.8"
     exon            14..933
                     /gene="KNOP1"
                     /gene_synonym="101F10.1; C16orf88; FAM191A; TSG118"
                     /inference="alignment:Splign:1.39.8"
     CDS             16..1392
                     /gene="KNOP1"
                     /gene_synonym="101F10.1; C16orf88; FAM191A; TSG118"
                     /note="family with sequence similarity 191, member A;
                     protein C16orf88; testis-specific gene 118 protein"
                     /codon_start=1
                     /product="lysine-rich nucleolar protein 1"
                     /protein_id="NP_001013009.2"
                     /db_xref="CCDS:CCDS42127.1"
                     /db_xref="GeneID:400506"
                     /db_xref="HGNC:HGNC:34404"
                     /translation="MITKTHKVDLGLPEKKKKKKVVKEPETRYSVLNNDDYFADVSPL
                     RATSPSKSVAHGQAPEMPLVKKKKKKKKGVSTLCEEHVEPETTLPARRTEKSPSLRKQ
                     VFGHLEFLSGEKKNKKSPLAMSHASGVKTSPDPRQGEEETRVGKKLKKHKKEKKGAQD
                     PTAFSVQDPWFCEAREARDVGDTCSVGKKDEEQAALGQKRKRKSPREHNGKVKKKKKI
                     HQEGDALPGHSKPSRSMESSPRKGSKKKPVKVEAPEYIPISDDPKASAKKKMKSKKKV
                     EQPVIEEPALKRKKKKKRKESGVAGDPWKEETDTDLEVVLEKKGNMDEAHIDQVRRKA
                     LQEEIDRESGKTEASETRKWTGTQFGQWDTAGFENEDQKLKFLRLMGGFKNLSPSFSR
                     PASTIARPNMALGKKAADSLQQNLQRDYDRAMSWKYSRGAGLGFSTAPNKIFYIDRNA
                     SKSVKLED"
     misc_feature    139..141
                     /gene="KNOP1"
                     /gene_synonym="101F10.1; C16orf88; FAM191A; TSG118"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine. {ECO:0000244|PubMed:17693683,
                     ECO:0000244|PubMed:18669648, ECO:0000244|PubMed:20068231,
                     ECO:0000244|PubMed:21406692, ECO:0000244|PubMed:23186163,
                     ECO:0000244|PubMed:24275569}; propagated from
                     UniProtKB/Swiss-Prot (Q1ED39.1); phosphorylation site"
     misc_feature    163..165
                     /gene="KNOP1"
                     /gene_synonym="101F10.1; C16orf88; FAM191A; TSG118"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine. {ECO:0000244|PubMed:18669648};
                     propagated from UniProtKB/Swiss-Prot (Q1ED39.1);
                     phosphorylation site"
     misc_feature    346..348
                     /gene="KNOP1"
                     /gene_synonym="101F10.1; C16orf88; FAM191A; TSG118"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine. {ECO:0000244|PubMed:20068231,
                     ECO:0000244|PubMed:23186163}; propagated from
                     UniProtKB/Swiss-Prot (Q1ED39.1); phosphorylation site"
     misc_feature    409..411
                     /gene="KNOP1"
                     /gene_synonym="101F10.1; C16orf88; FAM191A; TSG118"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine. {ECO:0000244|PubMed:23186163};
                     propagated from UniProtKB/Swiss-Prot (Q1ED39.1);
                     phosphorylation site"
     misc_feature    808..810
                     /gene="KNOP1"
                     /gene_synonym="101F10.1; C16orf88; FAM191A; TSG118"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine. {ECO:0000244|PubMed:18669648,
                     ECO:0000244|PubMed:23186163}; propagated from
                     UniProtKB/Swiss-Prot (Q1ED39.1); phosphorylation site"
     misc_feature    931..1389
                     /gene="KNOP1"
                     /gene_synonym="101F10.1; C16orf88; FAM191A; TSG118"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q1ED39.1);
                     Region: Interaction with ZNF106. {ECO:0000250}"
     misc_feature    937..939
                     /gene="KNOP1"
                     /gene_synonym="101F10.1; C16orf88; FAM191A; TSG118"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphothreonine. {ECO:0000244|PubMed:18669648};
                     propagated from UniProtKB/Swiss-Prot (Q1ED39.1);
                     phosphorylation site"
     misc_feature    943..945
                     /gene="KNOP1"
                     /gene_synonym="101F10.1; C16orf88; FAM191A; TSG118"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphothreonine. {ECO:0000244|PubMed:18669648,
                     ECO:0000244|PubMed:23186163}; propagated from
                     UniProtKB/Swiss-Prot (Q1ED39.1); phosphorylation site"
     STS             22..240
                     /gene="KNOP1"
                     /gene_synonym="101F10.1; C16orf88; FAM191A; TSG118"
                     /standard_name="D8S1410E"
                     /db_xref="UniSTS:151203"
     STS             724..870
                     /gene="KNOP1"
                     /gene_synonym="101F10.1; C16orf88; FAM191A; TSG118"
                     /standard_name="RH48839"
                     /db_xref="UniSTS:14050"
     exon            934..1002
                     /gene="KNOP1"
                     /gene_synonym="101F10.1; C16orf88; FAM191A; TSG118"
                     /inference="alignment:Splign:1.39.8"
     exon            1003..1080
                     /gene="KNOP1"
                     /gene_synonym="101F10.1; C16orf88; FAM191A; TSG118"
                     /inference="alignment:Splign:1.39.8"
     exon            1081..1950
                     /gene="KNOP1"
                     /gene_synonym="101F10.1; C16orf88; FAM191A; TSG118"
                     /inference="alignment:Splign:1.39.8"
     STS             1594..1727
                     /gene="KNOP1"
                     /gene_synonym="101F10.1; C16orf88; FAM191A; TSG118"
                     /standard_name="RH69601"
                     /db_xref="UniSTS:88603"
ORIGIN     
        1 atttcgccca ccggaatgat caccaagaca cacaaagtag accttgggct cccagagaag
       61 aaaaagaaga agaaagtggt caaagaacca gagactcgat actcagtttt aaacaatgat
      121 gattactttg ctgatgtttc tcctttaaga gctacatccc cctctaagag tgtggcccat
      181 gggcaggcac ctgagatgcc tctagtgaag aaaaagaaga agaaaaagaa gggtgtcagc
      241 accctttgcg aggagcatgt agaacctgag accacgctgc ctgctagacg gacagagaag
      301 tcacccagcc tcaggaagca ggtgtttggc cacttggagt tcctcagtgg ggaaaagaaa
      361 aataagaagt cacctctagc catgtcccat gcctctgggg tgaaaacctc cccagaccct
      421 agacagggtg aggaggaaac cagagttggc aagaagctca aaaaacacaa gaaggaaaaa
      481 aagggggccc aggaccccac agccttctcg gtccaggacc cttggttctg tgaggccagg
      541 gaggccaggg atgttgggga cacttgctca gtggggaaga aggatgagga acaggcagcc
      601 ttggggcaga aacggaagcg gaagagcccc agagaacaca atgggaaggt gaagaagaaa
      661 aaaaaaatcc accaggaggg agatgccctc ccaggccact ccaagccctc caggtccatg
      721 gagagcagcc ctaggaaagg aagtaaaaag aagccagtca aagttgaggc tccggaatac
      781 atccccataa gtgatgaccc taaggcctcc gcaaagaaaa agatgaagtc caaaaagaag
      841 gtagagcagc cagtcatcga ggagccagct ctgaaaagga agaaaaagaa gaagaggaaa
      901 gagagtgggg tagcaggaga cccttggaag gaggaaacag acacggactt agaggtggtg
      961 ttggaaaaaa aaggcaacat ggatgaggcg cacatagacc aggtgaggcg aaaggccttg
     1021 caagaagaga tcgatcgcga gtcaggcaaa acggaagctt ctgaaaccag gaagtggacg
     1081 ggaacccagt ttggccagtg ggatactgct ggttttgaga acgaggacca aaaactgaaa
     1141 tttctcagac ttatgggtgg cttcaaaaac ctgtcccctt cgttcagccg ccccgccagc
     1201 acgattgcaa ggcccaacat ggccctcggc aagaaggcgg ctgacagcct gcagcagaat
     1261 ctgcagcggg actacgaccg ggccatgagc tggaagtaca gccggggagc cggcctcggc
     1321 ttctccaccg cccccaacaa gatcttttac attgacagga acgcttccaa gtcagtcaag
     1381 ctggaagatt aaactctaga gttttgtccc cccaaaactg ccacaattgc tttgattatt
     1441 ccatttatgc tggagattac aaattttttt tgtgaaaaaa tcagatcttg gtgaggacct
     1501 cgagcagtaa gatataaata actcccataa gcttagcgtt ccagtaatgg aacactaggc
     1561 ataaatggtt tattcagttg tgcaaatgaa agccatctga cagttggctc acattgaaca
     1621 cctgtggaga ttaaggacga ggacaactat attgatgggc ttggatgaac tggggcaggg
     1681 cagctcatat ttcgggagcc aggagaacga gtgagtgcta aaacctcctg ttttctgtgt
     1741 taaacattcc gtccctgttt gagacatcag tatgtacagt taacttttgt tgagtgttta
     1801 gcaggtacta gggacatact agtgttttcc ttaatgtatt taatcttcat aattatgaaa
     1861 tgggtgctat tattagcccc atcttataga tgaggcaact gaggttcagg gataaagtaa
     1921 taaaattgcc tggggtcacc cagccactaa aaaaaaaaaa aaaaaaaaaa aaaa
//

349

Re: Формы, механизмы, энергия наномира - 84

https://www.ncbi.nlm.nih.gov/protein/57 … CR2ZZS6015

https://www.ncbi.nlm.nih.gov/nuccore/1034594159

PREDICTED: Homo sapiens serine/arginine repetitive matrix 2 (SRRM2), transcript variant X16, mRNA
NCBI Reference Sequence: XM_006720874.3
FASTA Graphics
Go to:
LOCUS       XM_006720874            2466 bp    mRNA    linear   PRI 06-JUN-2016
DEFINITION  PREDICTED: Homo sapiens serine/arginine repetitive matrix 2
            (SRRM2), transcript variant X16, mRNA.
ACCESSION   XM_006720874
VERSION     XM_006720874.3
DBLINK      BioProject: PRJNA168
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_000016.10) annotated using gene prediction method: Gnomon,
            supported by mRNA and EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
           
            On Jun 6, 2016 this sequence version replaced gi:767987095.
           
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Homo sapiens Annotation Release 108
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2466
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="16"
     gene            1..2466
                     /gene="SRRM2"
                     /gene_synonym="300-KD; Cwc21; CWF21; HSPC075; SRL300;
                     SRm300"
                     /note="serine/arginine repetitive matrix 2; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 6 mRNAs, 43 ESTs, 84 long SRA reads, 5 Proteins, and
                     100% coverage of the annotated genomic feature by RNAseq
                     alignments, including 52 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:23524"
                     /db_xref="HGNC:HGNC:16639"
                     /db_xref="MIM:606032"
     CDS             528..1403
                     /gene="SRRM2"
                     /gene_synonym="300-KD; Cwc21; CWF21; HSPC075; SRL300;
                     SRm300"
                     /codon_start=1
                     /product="serine/arginine repetitive matrix protein 2
                     isoform X2"
                     /protein_id="XP_006720937.1"
                     /db_xref="GeneID:23524"
                     /db_xref="HGNC:HGNC:16639"
                     /db_xref="MIM:606032"
                     /translation="MYNGIGLPTPRGSGTNGYVQRNLSLVRGRRGERPDYKGEEELRR
                     LEAALVKRPNPDILDHERKRRVELRCLELEEMMEEQGYEEQQIQEKVATFRLMLLEKD
                     VNPGGKEETPGQRPAVTETHQLAELNEKKNERLRAAFGISDSYVDGSSFDPQRRAREA
                     KQPAPEPPKPYSLVRESSSSRSPTPKQKKKKKKKDRGRRSESSSPRRERKKSSKKKKH
                     RSESESKKRKHRSPTPKSKRKSKDKKRKRSRSTTPAPKSRRAHRSTSADSASSSDTSR
                     SRRCTDHSEDTVPAL"
ORIGIN     
        1 ggagacgaga cgcgctcggg cgtcgctttg ctgccgctag gccctgtgct cctccccgca
       61 gcggaaggcc tacgaatacg cggtgtctta cgtcgcttcc tccgttcttc gttgcactgg
      121 ccaacgggac gcttagtctt tcggcaacgg ggtgaaacct tccttgtgcc tgaaaaaacg
      181 gtacttcgcg gtgtggcttc ggcgcctgcg caaaaggccg cggggcgcac tccagttccc
      241 ggcaggcccc gcgacgcgcg tttgcgtgct gacgcacgca gttagtcgtg ctgacgtgca
      301 gcgcggccca ggcggggtgc gagtggcgca gttggagccc gttgcggccc ctgaggaagc
      361 gaggaggcgt cggcgtcggc tgaggcgggc ggaccggcga ggcgaggcgg cggccccagg
      421 cccgagggac tcgggagctc gagcagcggc ggcggcaaga cctctccccc tcggaggcgg
      481 cgggcggagg cggcgggagc ggtggtgccc cccccgggca cggggccatg tacaacggga
      541 tcgggctgcc gacgccccgg ggcagcggca ccaacggcta cgtccagcgc aacctgtccc
      601 tggtgcgggg ccgccggggt gagcggcctg actacaaggg agaggaggaa ctgcggcgcc
      661 tggaggctgc cctggtgaag cggcctaatc ctgacatcct ggaccacgag cgcaagcggc
      721 gcgtcgagct gcgatgcctc gagctggagg agatgatgga agagcagggg tacgaggaac
      781 agcaaattca ggaaaaagtg gcgacctttc gactcatgtt gctggagaag gatgtgaacc
      841 ctgggggcaa ggaggagacc ccagggcaga ggccagcggt cacggagact caccagttgg
      901 cagaattaaa tgagaagaag aatgaaagac tccgtgctgc ctttggcatc agtgattctt
      961 acgtagatgg cagctctttt gatcctcagc gtcgtgcccg agaagctaaa caaccagctc
     1021 ctgagcctcc caaaccttac agccttgttc gggagtctag cagttctcgc tcaccaaccc
     1081 caaagcagaa gaagaagaaa aagaagaaag atagaggacg caggtcagag agcagctctc
     1141 ctcgacggga gagaaagaaa agctcaaaga agaagaagca caggtcagaa tctgagtcca
     1201 agaaacgtaa gcataggtct cccactccaa agagcaaacg taaatctaag gacaaaaagc
     1261 gaaagcggtc tcgaagtaca acaccagccc ccaagagccg ccgggcccac cgttcaactt
     1321 ctgctgactc tgcttcctcc tccgatactt cccgcagtcg gcgctgcaca gaccattcgg
     1381 aagacacggt ccctgccctc taggagctga caggctaaag caacaggatg gacagacata
     1441 tacatttccc cttctctttt tttttttgtt tttgtttatt tgttattttt gtttcgttct
     1501 gatgtatatg gactgccaga ataggggggg tggtggtttg ttcgtggtgt ctgggggagg
     1561 aaggaatcct taccctggct tccttaatcg gggaaggctt cctgaaggag gtgggctcag
     1621 aggtgagttg tgaatgaagc gggtagggag tgggctgggt ggatggtttg gggatgtttg
     1681 ggggaggtga gtaaaggggt agagggagaa cgctctttgg gattgtgttg ggaaaagaag
     1741 aaccaaagtg gactgtactt gcatttcagt gaatgatttg agttgtgcga ctaaaggctt
     1801 tttggaagag ggttgtccag ttaggaaagg tggatgggag ttggggaggg ggttttctgt
     1861 tctccctttg agctgatttc cttcctctcc cacgtcctca attaactcct gcaggtctcg
     1921 aagtgctgca gctaaaactc atacaactgc cttggctggg cgaagtcctt cccctgcttc
     1981 agggcgacgc ggggagggag atgcgccttt cagtgaacca ggtactacca gcacacaacg
     2041 gcctagtagc ccggagactg ctacgaaaca gcctagcagc ccttatgaag acaaagataa
     2101 agacaagaag gaggtatgtt cctgagttgg tgatgttcat tggattgcaa atgtatagat
     2161 ttaggataga catgtgatgt gaaagggaga ggtaataact tattaaaata aataaattca
     2221 gttttttttc ctgcatttct ctcctagttc tcttactgca tctgcagaac ttttagtgtt
     2281 gttactagac tgaattgtga accctttaga atcaaatctc actggatgtt aggttttata
     2341 ttgtgtcttg tttatacata gatagaactg gaacaaacgt tgtatcttat ctgtgtactc
     2401 cgtatgatgc ctctagtttc ttctcttttt tcattaaatg ctggtcatgt ctcaccaaaa
     2461 cttttt
//

FT CDS 528..1403
        1 ggagacgaga cgcgctcggg cgtcgctttg ctgccgctag gccctgtgct cctccccgca
       61 gcggaaggcc tacgaatacg cggtgtctta cgtcgcttcc tccgttcttc gttgcactgg
      121 ccaacgggac gcttagtctt tcggcaacgg ggtgaaacct tccttgtgcc tgaaaaaacg
      181 gtacttcgcg gtgtggcttc ggcgcctgcg caaaaggccg cggggcgcac tccagttccc
      241 ggcaggcccc gcgacgcgcg tttgcgtgct gacgcacgca gttagtcgtg ctgacgtgca
      301 gcgcggccca ggcggggtgc gagtggcgca gttggagccc gttgcggccc ctgaggaagc
      361 gaggaggcgt cggcgtcggc tgaggcgggc ggaccggcga ggcgaggcgg cggccccagg
      421 cccgagggac tcgggagctc gagcagcggc ggcggcaaga cctctccccc tcggaggcgg
      481 cgggcggagg cggcgggagc ggtggtgccc cccccgggca cggggccatg tacaacggga
      541 tcgggctgcc gacgccccgg ggcagcggca ccaacggcta cgtccagcgc aacctgtccc
      601 tggtgcgggg ccgccggggt gagcggcctg actacaaggg agaggaggaa ctgcggcgcc
      661 tggaggctgc cctggtgaag cggcctaatc ctgacatcct ggaccacgag cgcaagcggc
      721 gcgtcgagct gcgatgcctc gagctggagg agatgatgga agagcagggg tacgaggaac
      781 agcaaattca ggaaaaagtg gcgacctttc gactcatgtt gctggagaag gatgtgaacc
      841 ctgggggcaa ggaggagacc ccagggcaga ggccagcggt cacggagact caccagttgg
      901 cagaattaaa tgagaagaag aatgaaagac tccgtgctgc ctttggcatc agtgattctt
      961 acgtagatgg cagctctttt gatcctcagc gtcgtgcccg agaagctaaa caaccagctc
     1021 ctgagcctcc caaaccttac agccttgttc gggagtctag cagttctcgc tcaccaaccc
     1081 caaagcagaa gaagaagaaa aagaagaaag atagaggacg caggtcagag agcagctctc
     1141 ctcgacggga gagaaagaaa agctcaaaga agaagaagca caggtcagaa tctgagtcca
     1201 agaaacgtaa gcataggtct cccactccaa agagcaaacg taaatctaag gacaaaaagc
     1261 gaaagcggtc tcgaagtaca acaccagccc ccaagagccg ccgggcccac cgttcaactt
     1321 ctgctgactc tgcttcctcc tccgatactt cccgcagtcg gcgctgcaca gaccattcgg
     1381 aagacacggt ccctgccctc taggagctga caggctaaag caacaggatg gacagacata
     1441 tacatttccc cttctctttt tttttttgtt tttgtttatt tgttattttt gtttcgttct
     1501 gatgtatatg gactgccaga ataggggggg tggtggtttg ttcgtggtgt ctgggggagg
     1561 aaggaatcct taccctggct tccttaatcg gggaaggctt cctgaaggag gtgggctcag
     1621 aggtgagttg tgaatgaagc gggtagggag tgggctgggt ggatggtttg gggatgtttg
     1681 ggggaggtga gtaaaggggt agagggagaa cgctctttgg gattgtgttg ggaaaagaag
     1741 aaccaaagtg gactgtactt gcatttcagt gaatgatttg agttgtgcga ctaaaggctt
     1801 tttggaagag ggttgtccag ttaggaaagg tggatgggag ttggggaggg ggttttctgt
     1861 tctccctttg agctgatttc cttcctctcc cacgtcctca attaactcct gcaggtctcg
     1921 aagtgctgca gctaaaactc atacaactgc cttggctggg cgaagtcctt cccctgcttc
     1981 agggcgacgc ggggagggag atgcgccttt cagtgaacca ggtactacca gcacacaacg
     2041 gcctagtagc ccggagactg ctacgaaaca gcctagcagc ccttatgaag acaaagataa
     2101 agacaagaag gaggtatgtt cctgagttgg tgatgttcat tggattgcaa atgtatagat
     2161 ttaggataga catgtgatgt gaaagggaga ggtaataact tattaaaata aataaattca
     2221 gttttttttc ctgcatttct ctcctagttc tcttactgca tctgcagaac ttttagtgtt
     2281 gttactagac tgaattgtga accctttaga atcaaatctc actggatgtt aggttttata
     2341 ttgtgtcttg tttatacata gatagaactg gaacaaacgt tgtatcttat ctgtgtactc
     2401 cgtatgatgc ctctagtttc ttctcttttt tcattaaatg ctggtcatgt ctcaccaaaa
     2461 cttttt
//

https://img-fotki.yandex.ru/get/172017/ … 9_orig.gif

350

Re: Формы, механизмы, энергия наномира - 84

https://www.ncbi.nlm.nih.gov/protein/93 … CR2ZZS6015

https://www.ncbi.nlm.nih.gov/nuccore/939320331

Homo sapiens eukaryotic translation initiation factor 2 subunit beta (EIF2S2), transcript variant 2, mRNA
NCBI Reference Sequence: NM_001316363.1
FASTA Graphics
Go to:
LOCUS       NM_001316363            2688 bp    mRNA    linear   PRI 08-OCT-2016
DEFINITION  Homo sapiens eukaryotic translation initiation factor 2 subunit
            beta (EIF2S2), transcript variant 2, mRNA.
ACCESSION   NM_001316363
VERSION     NM_001316363.1
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2688)
  AUTHORS   Siddiq A, Couch FJ, Chen GK, Lindstrom S, Eccles D, Millikan RC,
            Michailidou K, Stram DO, Beckmann L, Rhie SK, Ambrosone CB,
            Aittomaki K, Amiano P, Apicella C, Baglietto L, Bandera EV,
            Beckmann MW, Berg CD, Bernstein L, Blomqvist C, Brauch H, Brinton
            L, Bui QM, Buring JE, Buys SS, Campa D, Carpenter JE, Chasman DI,
            Chang-Claude J, Chen C, Clavel-Chapelon F, Cox A, Cross SS, Czene
            K, Deming SL, Diasio RB, Diver WR, Dunning AM, Durcan L, Ekici AB,
            Fasching PA, Feigelson HS, Fejerman L, Figueroa JD, Fletcher O,
            Flesch-Janys D, Gaudet MM, Gerty SM, Rodriguez-Gil JL, Giles GG,
            van Gils CH, Godwin AK, Graham N, Greco D, Hall P, Hankinson SE,
            Hartmann A, Hein R, Heinz J, Hoover RN, Hopper JL, Hu JJ, Huntsman
            S, Ingles SA, Irwanto A, Isaacs C, Jacobs KB, John EM, Justenhoven
            C, Kaaks R, Kolonel LN, Coetzee GA, Lathrop M, Le Marchand L, Lee
            AM, Lee IM, Lesnick T, Lichtner P, Liu J, Lund E, Makalic E, Martin
            NG, McLean CA, Meijers-Heijboer H, Meindl A, Miron P, Monroe KR,
            Montgomery GW, Muller-Myhsok B, Nickels S, Nyante SJ, Olswold C,
            Overvad K, Palli D, Park DJ, Palmer JR, Pathak H, Peto J, Pharoah
            P, Rahman N, Rivadeneira F, Schmidt DF, Schmutzler RK, Slager S,
            Southey MC, Stevens KN, Sinn HP, Press MF, Ross E, Riboli E, Ridker
            PM, Schumacher FR, Severi G, Dos Santos Silva I, Stone J, Sund M,
            Tapper WJ, Thun MJ, Travis RC, Turnbull C, Uitterlinden AG,
            Waisfisz Q, Wang X, Wang Z, Weaver J, Schulz-Wendtland R, Wilkens
            LR, Van Den Berg D, Zheng W, Ziegler RG, Ziv E, Nevanlinna H,
            Easton DF, Hunter DJ, Henderson BE, Chanock SJ, Garcia-Closas M,
            Kraft P, Haiman CA and Vachon CM.
  CONSRTM   Australian Breast Cancer Tissue Bank Investigators; Familial Breast
            Cancer Study; GENICA Consortium
  TITLE     A meta-analysis of genome-wide association studies of breast cancer
            identifies two novel susceptibility loci at 6q14 and 20q11
  JOURNAL   Hum. Mol. Genet. 21 (24), 5373-5384 (2012)
   PUBMED   22976474
REFERENCE   2  (bases 1 to 2688)
  AUTHORS   Luna RE, Arthanari H, Hiraishi H, Nanda J, Martin-Marcos P, Markus
            MA, Akabayov B, Milbradt AG, Luna LE, Seo HC, Hyberts SG, Fahmy A,
            Reibarkh M, Miles D, Hagner PR, O'Day EM, Yi T, Marintchev A,
            Hinnebusch AG, Lorsch JR, Asano K and Wagner G.
  TITLE     The C-terminal domain of eukaryotic initiation factor 5 promotes
            start codon recognition by its dynamic interplay with eIF1 and
            eIF2beta
  JOURNAL   Cell Rep 1 (6), 689-702 (2012)
   PUBMED   22813744
  REMARK    GeneRIF: This study provides mechanistic insight into the role of
            eIF5-carboxyl terminal domain's dynamic interplay with eIF1 and
            eIF2beta
REFERENCE   3  (bases 1 to 2688)
  AUTHORS   Baltz AG, Munschauer M, Schwanhausser B, Vasile A, Murakawa Y,
            Schueler M, Youngs N, Penfold-Brown D, Drew K, Milek M, Wyler E,
            Bonneau R, Selbach M, Dieterich C and Landthaler M.
  TITLE     The mRNA-bound proteome and its global occupancy profile on
            protein-coding transcripts
  JOURNAL   Mol. Cell 46 (5), 674-690 (2012)
   PUBMED   22681889
REFERENCE   4  (bases 1 to 2688)
  AUTHORS   Castello A, Fischer B, Eichelbaum K, Horos R, Beckmann BM, Strein
            C, Davey NE, Humphreys DT, Preiss T, Steinmetz LM, Krijgsveld J and
            Hentze MW.
  TITLE     Insights into RNA biology from an atlas of mammalian mRNA-binding
            proteins
  JOURNAL   Cell 149 (6), 1393-1406 (2012)
   PUBMED   22658674
REFERENCE   5  (bases 1 to 2688)
  AUTHORS   Rajesh K, Iyer A, Suragani RN and Ramaiah KV.
  TITLE     Intersubunit and interprotein interactions of alpha- and
            beta-subunits of human eIF2: Effect of phosphorylation
  JOURNAL   Biochem. Biophys. Res. Commun. 374 (2), 336-340 (2008)
   PUBMED   18639529
  REMARK    GeneRIF: These findings suggest that alpha and beta subunits of
            eIF2 interact with each other and the beta-subunit plays a critical
            role both in the regulation and function of eIF2.
REFERENCE   6  (bases 1 to 2688)
  AUTHORS   Das S, Maiti T, Das K and Maitra U.
  TITLE     Specific interaction of eukaryotic translation initiation factor 5
            (eIF5) with the beta-subunit of eIF2
  JOURNAL   J. Biol. Chem. 272 (50), 31712-31718 (1997)
   PUBMED   9395514
REFERENCE   7  (bases 1 to 2688)
  AUTHORS   Brand SR, Kobayashi R and Mathews MB.
  TITLE     The Tat protein of human immunodeficiency virus type 1 is a
            substrate and inhibitor of the interferon-induced, virally
            activated protein kinase, PKR
  JOURNAL   J. Biol. Chem. 272 (13), 8388-8395 (1997)
   PUBMED   9079663
REFERENCE   8  (bases 1 to 2688)
  AUTHORS   Welsh GI, Price NT, Bladergroen BA, Bloomberg G and Proud CG.
  TITLE     Identification of novel phosphorylation sites in the beta-subunit
            of translation initiation factor eIF-2
  JOURNAL   Biochem. Biophys. Res. Commun. 201 (3), 1279-1288 (1994)
   PUBMED   8024572
REFERENCE   9  (bases 1 to 2688)
  AUTHORS   Pathak VK, Nielsen PJ, Trachsel H and Hershey JW.
  TITLE     Structure of the beta subunit of translational initiation factor
            eIF-2
  JOURNAL   Cell 54 (5), 633-639 (1988)
   PUBMED   3044606
REFERENCE   10 (bases 1 to 2688)
  AUTHORS   Safer,B., Adams,S.L., Anderson,W.F. and Merrick,W.C.
  TITLE     Binding of MET-TRNAf and GTP to homogeneous initiation factor MP
  JOURNAL   J. Biol. Chem. 250 (23), 9076-9082 (1975)
   PUBMED   1104615
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from HY005227.1, BX429051.2,
            AL031668.23 and CA436754.1.
           
            Summary: Eukaryotic translation initiation factor 2 (EIF-2)
            functions in the early steps of protein synthesis by forming a
            ternary complex with GTP and initiator tRNA and binding to a 40S
            ribosomal subunit. EIF-2 is composed of three subunits, alpha,
            beta, and gamma, with the protein encoded by this gene representing
            the beta subunit. The beta subunit catalyzes the exchange of GDP
            for GTP, which recycles the EIF-2 complex for another round of
            initiation. Multiple transcript variants encoding different
            isoforms have been found for this gene. [provided by RefSeq, Oct
            2015].
           
            Transcript Variant: This variant (2) uses an alternate in-frame
            splice junction at the 5' end of an exon compared to variant 1. The
            resulting isoform (2) has the same N- and C-termini but is shorter
            compared to isoform 1.
           
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
           
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
           
            ##Evidence-Data-START##
            Transcript exon combination :: BX443349.2, BX429051.2 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           SAMEA1965299, SAMEA1966682
                                           [ECO:0000350]
            ##Evidence-Data-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-154               HY005227.1         2-155
            155-280             BX429051.2         1-126
            281-281             AL031668.23        89312-89312         c
            282-305             BX429051.2         128-151
            306-306             AL031668.23        89287-89287         c
            307-1043            BX429051.2         153-889
            1044-1073           BX429051.2         891-920
            1074-2623           AL031668.23        72132-73681         c
            2624-2688           CA436754.1         1-65                c
FEATURES             Location/Qualifiers
     source          1..2688
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="20"
                     /map="20q11.22"
     gene            1..2688
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
                     /note="eukaryotic translation initiation factor 2 subunit
                     beta"
                     /db_xref="GeneID:8894"
                     /db_xref="HGNC:HGNC:3266"
                     /db_xref="MIM:603908"
     exon            1..261
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
                     /inference="alignment:Splign:2.0.8"
     misc_feature    208..210
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
                     /note="upstream in-frame stop codon"
     CDS             247..1239
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
                     /note="isoform 2 is encoded by transcript variant 2;
                     eukaryotic translation initiation factor 2 subunit 2;
                     protein phosphatase 1, regulatory subunit 67; eukaryotic
                     translation initiation factor 2, subunit 2 beta, 38kDa"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 2
                     subunit 2 isoform 2"
                     /protein_id="NP_001303292.1"
                     /db_xref="GeneID:8894"
                     /db_xref="HGNC:HGNC:3266"
                     /db_xref="MIM:603908"
                     /translation="MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEV
                     EPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKIES
                     DVQEPTEPEDDLDIMLGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQT
                     GPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVN
                     FTDICKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYV
                     TCHTCRSPDTILQKDTRLYFLQCETCHSRCSVASIKTGFQAVTGKRAQLRAKAN"
     misc_feature    250..252
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="N-acetylserine. {ECO:0000244|PubMed:19413330,
                     ECO:0000244|PubMed:21406692, ECO:0000244|PubMed:22223895};
                     propagated from UniProtKB/Swiss-Prot (P20042.2);
                     acetylation site"
     misc_feature    250..252
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine. {ECO:0000244|PubMed:17081983,
                     ECO:0000244|PubMed:20068231, ECO:0000244|PubMed:21406692,
                     ECO:0000244|PubMed:23186163}; propagated from
                     UniProtKB/Swiss-Prot (P20042.2); phosphorylation site"
     misc_feature    283..285
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine. {ECO:0000244|PubMed:23186163};
                     propagated from UniProtKB/Swiss-Prot (P20042.2);
                     phosphorylation site"
     misc_feature    337..339
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphothreonine. {ECO:0000244|PubMed:23186163};
                     propagated from UniProtKB/Swiss-Prot (P20042.2);
                     phosphorylation site"
     misc_feature    352..354
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphothreonine. {ECO:0000244|PubMed:23186163};
                     propagated from UniProtKB/Swiss-Prot (P20042.2);
                     phosphorylation site"
     misc_feature    445..447
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine. {ECO:0000244|PubMed:20068231,
                     ECO:0000244|PubMed:21406692, ECO:0000244|PubMed:23186163};
                     propagated from UniProtKB/Swiss-Prot (P20042.2);
                     phosphorylation site"
     misc_feature    550..552
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine. {ECO:0000244|PubMed:19690332,
                     ECO:0000244|PubMed:21406692, ECO:0000244|PubMed:23186163};
                     propagated from UniProtKB/Swiss-Prot (P20042.2);
                     phosphorylation site"
     misc_feature    568..570
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphothreonine. {ECO:0000244|PubMed:19690332,
                     ECO:0000244|PubMed:21406692, ECO:0000244|PubMed:23186163};
                     propagated from UniProtKB/Swiss-Prot (P20042.2);
                     phosphorylation site"
     misc_feature    709..711
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine. {ECO:0000244|PubMed:20068231};
                     propagated from UniProtKB/Swiss-Prot (P20042.2);
                     phosphorylation site"
     misc_feature    889..891
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine. {ECO:0000250|UniProtKB:P41035};
                     propagated from UniProtKB/Swiss-Prot (P20042.2);
                     phosphorylation site"
     misc_feature    1030..1032
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="N6-acetyllysine. {ECO:0000244|PubMed:19608861};
                     propagated from UniProtKB/Swiss-Prot (P20042.2);
                     acetylation site"
     misc_feature    1114..1116
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="N6-acetyllysine. {ECO:0000244|PubMed:19608861};
                     propagated from UniProtKB/Swiss-Prot (P20042.2);
                     acetylation site"
     exon            262..439
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
                     /inference="alignment:Splign:2.0.8"
     exon            440..543
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
                     /inference="alignment:Splign:2.0.8"
     exon            544..670
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
                     /inference="alignment:Splign:2.0.8"
     exon            671..771
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
                     /inference="alignment:Splign:2.0.8"
     exon            772..920
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
                     /inference="alignment:Splign:2.0.8"
     exon            921..977
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
                     /inference="alignment:Splign:2.0.8"
     exon            978..1063
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
                     /inference="alignment:Splign:2.0.8"
     exon            1064..2671
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
                     /inference="alignment:Splign:2.0.8"
     STS             1109..1276
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
                     /standard_name="RH35846"
                     /db_xref="UniSTS:36859"
     STS             1243..1501
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
                     /standard_name="SHGC-12418"
                     /db_xref="UniSTS:89114"
     STS             1274..1401
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
                     /standard_name="G62049"
                     /db_xref="UniSTS:139150"
     regulatory      1320..1325
                     /regulatory_class="polyA_signal_sequence"
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
     polyA_site      1347
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
     regulatory      1508..1513
                     /regulatory_class="polyA_signal_sequence"
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
     polyA_site      1538
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
     STS             2324..2491
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
                     /standard_name="D20S573E"
                     /db_xref="UniSTS:40668"
     STS             2357..2626
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
                     /standard_name="RH12277"
                     /db_xref="UniSTS:56347"
     STS             2432..2622
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
                     /standard_name="RH11633"
                     /db_xref="UniSTS:1888"
     STS             2444..2579
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
                     /standard_name="D20S1129"
                     /db_xref="UniSTS:14386"
     STS             2459..2562
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
                     /standard_name="D20S773"
                     /db_xref="UniSTS:2664"
     regulatory      2630..2635
                     /regulatory_class="polyA_signal_sequence"
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
     polyA_site      2671
                     /gene="EIF2S2"
                     /gene_synonym="eIF-2-beta; EIF2; EIF2B; EIF2beta; PPP1R67"
ORIGIN     
        1 gtcgcctggt aactcgcgcc acacgaagcg cgctaggttg gctcttctgc gcgcctgcgc
       61 cttggcgagc tctgcgcagg cgcatttcca acgcttggag gagagggcgg ggtgtcgttt
      121 cctttcgctg atgcaagagc ctagtgcggt ggtgggagag gtatcggcag gggcagcgct
      181 gccgccgggg cctggggctg acccgtctga cttcccgtcc gtgccgagcc cactcgagcc
      241 gcagccatgt ctggggacga gatgattttt gatcctacta tgagcaagaa gaaaaagaag
      301 aagaagaagc cttttatgtt agatgaggaa ggggataccc aaacagagga aacccagcct
      361 tcagaaacaa aagaagtgga gccagagcca actgaggaca aggatttgga agctgatgaa
      421 gaggacacta ggaaaaaaga tgcttctgat gatctagatg acttgaactt ctttaatcaa
      481 aagaaaaaga agaaaaaaac taaaaagata tttgatattg atgaagctga agaaggtgta
      541 aagattgaaa gtgatgttca agaaccaact gaaccagagg atgaccttga cattatgctt
      601 ggcaataaaa agaagaaaaa gaagaatgtt aagttcccag atgaggatga aatactagag
      661 aaagatgaag ctctagaaga tgaagacaac aaaaaagatg atggtatctc attcagtaat
      721 cagacaggcc ctgcttgggc aggctcagaa agagactaca catacgagga gctgctgaat
      781 cgagtgttca acatcatgag ggaaaagaat ccagatatgg ttgctgggga gaaaaggaaa
      841 tttgtcatga aacctccaca agtcgtccga gtaggaacca agaaaacttc ttttgtcaac
      901 tttacagata tctgtaaact attacatcgt cagcccaaac atctccttgc atttttgttg
      961 gctgaattgg gtacaagtgg ttctatagat ggtaataacc aacttgtaat caaaggaaga
     1021 ttccaacaga aacagataga aaatgtcttg agaagatata tcaaggaata tgtcacttgt
     1081 cacacatgcc gatcaccgga cacaatcctg cagaaggaca cacgactcta tttcctacag
     1141 tgcgaaactt gtcattctag atgttctgtt gccagtatca aaaccggctt ccaggctgtc
     1201 acgggcaagc gagcacagct ccgtgccaaa gctaactaat ttgctaatca ctgattttgc
     1261 aaagcttgtt gtggagatgt ggctggacag gtttgccatc agagtggata taccgttgta
     1321 ttaaaaacaa gataaaaaag ctgccaagat ttttggcgag tggttggtct gaagtccttg
     1381 caagacgctg atgctcaagc tgttgacata ctcattgcct actttaacac ctgtcagaga
     1441 aacgtgatat ggggtaagga ggtgcttttt taaaatcgtt catagacttc tgtaaaatgc
     1501 aagataaatt aaagttatta taacagtgat tctttcaatt tggtttgtcc ttcagttttc
     1561 ttttctataa atgtgcttgg tgaaatcagc aagaaaccaa ccatataaaa cagtgtgtgc
     1621 cgggctctga ctgagaaact gaacaatggc aggcgcttca tctgggcagc catttttctt
     1681 ctctgcttct cttgagatac atagttaaag tagacacggc ctcccacgcg agtgtggtgg
     1741 gaccttgaga cttaggagga ttgcctgttt tcagtgtcca gggaatgact ccatagattt
     1801 gaattctttt ccgtatgtgg ggatggttgc tactacctca ccgccaagtc ctcccccagc
     1861 tgttaccaca tgagggaata caaggtgcta ggtaccctcc ttcctcgttg gccactaaga
     1921 ggtcttagaa acatagcctg taaatgtgtc ttgtaactgg cacactaaaa aagatcctag
     1981 ttgagcatct ctcttggtga ggaagcgatg tgtgtgcggt tcaggaaact cctccaagag
     2041 gaggaggagt ccaaacaggg atgccagagg aagctttccg ttttcctagc caacttgtgt
     2101 tctgggtttg aaaaagaccc accacaaatg ctttttctat tttctgattt aaaagtcgct
     2161 tttgaatatg accatgagaa accaagaaat gctgcttgtg tggtgctctg cttcctgagg
     2221 atttggctgg aaggggattc tccgctggca catgggagaa ggccatcttc tgtgtcggtg
     2281 ctgtgatctg ccttgttctc acttgctgag gataagggca tacacgctgc tcctcgcttt
     2341 cttgttgccc gacttcgtac taagcagctc aggagcagtc actcagaccc aaatgtcttg
     2401 actgtgttgt ttttaatcac tgtgaccctt aaagtacagg ccaagtgttg tcaaacacct
     2461 tggctaaaac agtggagggt gatgggtaaa gcagtagagg gccctcaacc cacacactgg
     2521 ctgaaactgc caccaactgc cacgatgaac ccaactgctg tttatgcccc cattttcctt
     2581 tttttgtatc tacacccaca cgattcccaa tgttggatat ttctacatga ataaagcaag
     2641 gatcagtgcc tcttatgtaa ttaacgctcc aaaaaaaaaa aaaaaaaa
//

FT CDS 247..1239
        1 gtcgcctggt aactcgcgcc acacgaagcg cgctaggttg gctcttctgc gcgcctgcgc
       61 cttggcgagc tctgcgcagg cgcatttcca acgcttggag gagagggcgg ggtgtcgttt
      121 cctttcgctg atgcaagagc ctagtgcggt ggtgggagag gtatcggcag gggcagcgct
      181 gccgccgggg cctggggctg acccgtctga cttcccgtcc gtgccgagcc cactcgagcc
      241 gcagccatgt ctggggacga gatgattttt gatcctacta tgagcaagaa gaaaaagaag
      301 aagaagaagc cttttatgtt agatgaggaa ggggataccc aaacagagga aacccagcct
      361 tcagaaacaa aagaagtgga gccagagcca actgaggaca aggatttgga agctgatgaa
      421 gaggacacta ggaaaaaaga tgcttctgat gatctagatg acttgaactt ctttaatcaa
      481 aagaaaaaga agaaaaaaac taaaaagata tttgatattg atgaagctga agaaggtgta
      541 aagattgaaa gtgatgttca agaaccaact gaaccagagg atgaccttga cattatgctt
      601 ggcaataaaa agaagaaaaa gaagaatgtt aagttcccag atgaggatga aatactagag
      661 aaagatgaag ctctagaaga tgaagacaac aaaaaagatg atggtatctc attcagtaat
      721 cagacaggcc ctgcttgggc aggctcagaa agagactaca catacgagga gctgctgaat
      781 cgagtgttca acatcatgag ggaaaagaat ccagatatgg ttgctgggga gaaaaggaaa
      841 tttgtcatga aacctccaca agtcgtccga gtaggaacca agaaaacttc ttttgtcaac
      901 tttacagata tctgtaaact attacatcgt cagcccaaac atctccttgc atttttgttg
      961 gctgaattgg gtacaagtgg ttctatagat ggtaataacc aacttgtaat caaaggaaga
     1021 ttccaacaga aacagataga aaatgtcttg agaagatata tcaaggaata tgtcacttgt
     1081 cacacatgcc gatcaccgga cacaatcctg cagaaggaca cacgactcta tttcctacag
     1141 tgcgaaactt gtcattctag atgttctgtt gccagtatca aaaccggctt ccaggctgtc
     1201 acgggcaagc gagcacagct ccgtgccaaa gctaactaat ttgctaatca ctgattttgc
     1261 aaagcttgtt gtggagatgt ggctggacag gtttgccatc agagtggata taccgttgta
     1321 ttaaaaacaa gataaaaaag ctgccaagat ttttggcgag tggttggtct gaagtccttg
     1381 caagacgctg atgctcaagc tgttgacata ctcattgcct actttaacac ctgtcagaga
     1441 aacgtgatat ggggtaagga ggtgcttttt taaaatcgtt catagacttc tgtaaaatgc
     1501 aagataaatt aaagttatta taacagtgat tctttcaatt tggtttgtcc ttcagttttc
     1561 ttttctataa atgtgcttgg tgaaatcagc aagaaaccaa ccatataaaa cagtgtgtgc
     1621 cgggctctga ctgagaaact gaacaatggc aggcgcttca tctgggcagc catttttctt
     1681 ctctgcttct cttgagatac atagttaaag tagacacggc ctcccacgcg agtgtggtgg
     1741 gaccttgaga cttaggagga ttgcctgttt tcagtgtcca gggaatgact ccatagattt
     1801 gaattctttt ccgtatgtgg ggatggttgc tactacctca ccgccaagtc ctcccccagc
     1861 tgttaccaca tgagggaata caaggtgcta ggtaccctcc ttcctcgttg gccactaaga
     1921 ggtcttagaa acatagcctg taaatgtgtc ttgtaactgg cacactaaaa aagatcctag
     1981 ttgagcatct ctcttggtga ggaagcgatg tgtgtgcggt tcaggaaact cctccaagag
     2041 gaggaggagt ccaaacaggg atgccagagg aagctttccg ttttcctagc caacttgtgt
     2101 tctgggtttg aaaaagaccc accacaaatg ctttttctat tttctgattt aaaagtcgct
     2161 tttgaatatg accatgagaa accaagaaat gctgcttgtg tggtgctctg cttcctgagg
     2221 atttggctgg aaggggattc tccgctggca catgggagaa ggccatcttc tgtgtcggtg
     2281 ctgtgatctg ccttgttctc acttgctgag gataagggca tacacgctgc tcctcgcttt
     2341 cttgttgccc gacttcgtac taagcagctc aggagcagtc actcagaccc aaatgtcttg
     2401 actgtgttgt ttttaatcac tgtgaccctt aaagtacagg ccaagtgttg tcaaacacct
     2461 tggctaaaac agtggagggt gatgggtaaa gcagtagagg gccctcaacc cacacactgg
     2521 ctgaaactgc caccaactgc cacgatgaac ccaactgctg tttatgcccc cattttcctt
     2581 tttttgtatc tacacccaca cgattcccaa tgttggatat ttctacatga ataaagcaag
     2641 gatcagtgcc tcttatgtaa ttaacgctcc aaaaaaaaaa aaaaaaaa
//

https://img-fotki.yandex.ru/get/195559/ … 7_orig.gif

https://img-fotki.yandex.ru/get/117474/158289418.3be/0_1701c5_af2ff51d_orig.png

https://img-fotki.yandex.ru/get/195559/158289418.3be/0_1701c6_3472c3df_orig.png

https://img-fotki.yandex.ru/get/195559/158289418.3be/0_1701c7_d391b155_orig.png

https://img-fotki.yandex.ru/get/117896/158289418.3be/0_1701d1_d47760d2_orig.png