331

Re: Формы, механизмы, энергия наномира - 84

https://www.ncbi.nlm.nih.gov/protein/11 … C0A790J015

PHD finger protein 20-like protein 1 isoform 1 [Homo sapiens]
NCBI Reference Sequence: NP_057102.4
Identical Proteins FASTA Graphics
Go to:
LOCUS       NP_057102               1017 aa            linear   PRI 15-MAR-2015
DEFINITION  PHD finger protein 20-like protein 1 isoform 1 [Homo sapiens].
ACCESSION   NP_057102
VERSION     NP_057102.4
DBSOURCE    REFSEQ: accession NM_016018.4
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (residues 1 to 1017)
  AUTHORS   Esteve PO, Terragni J, Deepti K, Chin HG, Dai N, Espejo A, Correa
            IR Jr, Bedford MT and Pradhan S.
  TITLE     Methyllysine reader plant homeodomain (PHD) finger protein 20-like
            1 (PHF20L1) antagonizes DNA (cytosine-5) methyltransferase 1
            (DNMT1) proteasomal degradation
  JOURNAL   J. Biol. Chem. 289 (12), 8277-8287 (2014)
   PUBMED   24492612
  REMARK    GeneRIF: Malignant brain tumor domain of PHF20L1 reads and controls
            enzyme levels of methylated DNMT1 in cells, thus representing a
            novel antagonist of DNMT1 degradation.
REFERENCE   2  (residues 1 to 1017)
  AUTHORS   Kim J, Daniel J, Espejo A, Lake A, Krishna M, Xia L, Zhang Y and
            Bedford MT.
  TITLE     Tudor, MBT and chromo domains gauge the degree of lysine
            methylation
  JOURNAL   EMBO Rep. 7 (4), 397-403 (2006)
   PUBMED   16415788
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            DB498348.1, BC002822.2, DA196349.1, AK057961.1 and AF230666.2.
            On Aug 3, 2006 this sequence version replaced gi:39653327.
           
            Transcript Variant: This variant (1) represents the longest
            transcript and it encodes the longest protein (isoform 1).
           
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMEA1965299,
                              SAMEA1966682 [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1017
                     /organism="Homo sapiens"
                     /db_xref="taxon:9606"
                     /chromosome="8"
                     /map="8q24.22"
     Protein         1..1017
                     /product="PHD finger protein 20-like protein 1 isoform 1"
                     /note="PHD finger protein 20-like protein 1; tudor
                     domain-containing protein PHF20L1; tudor domain containing
                     20B; up-regulated in lung cancer 1"
                     /calculated_mol_wt=114880
     Region          3..68
                     /region_name="MBT"
                     /note="mbt repeat; cl17705"
                     /db_xref="CDD:302657"
     Region          90..135
                     /region_name="TUDOR"
                     /note="Tudor domains are found in many eukaryotic
                     organisms and have been implicated in protein-protein
                     interactions in which methylated protein substrates bind
                     to these domains. For example, the Tudor domain of
                     Survival of Motor Neuron (SMN) binds to...; cd04508"
                     /db_xref="CDD:119391"
     Site            order(97,101,103,122,124)
                     /site_type="other"
                     /note="dimethylated arginine/lysine binding site [chemical
                     binding]"
                     /db_xref="CDD:119391"
     Region          210..317
                     /region_name="DUF3776"
                     /note="Protein of unknown function (DUF3776); pfam12618"
                     /db_xref="CDD:289391"
     Region          318..383
                     /region_name="PHD20L1_u1"
                     /note="PHD finger protein 20-like protein 1; pfam16660"
                     /db_xref="CDD:293265"
     Region          683..728
                     /region_name="PHD_PHF20L1"
                     /note="PHD finger found in PHD finger protein 20-like
                     protein 1 (P20L1); cd15633"
                     /db_xref="CDD:277103"
     Site            order(683,694..698,702,721)
                     /site_type="other"
                     /note="putative histone H3 binding site [polypeptide
                     binding]"
                     /db_xref="CDD:277103"
     Site            order(684,686,698,701,706,709,723,726)
                     /site_type="other"
                     /note="Zn binding site [ion binding]"
                     /db_xref="CDD:277103"
     Site            909
                     /site_type="acetylation"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="N6-acetyllysine. {ECO:0000269|PubMed:19608861};
                     propagated from UniProtKB/Swiss-Prot (A8MW92.2)"
     CDS             1..1017
                     /gene="PHF20L1"
                     /gene_synonym="CGI-72; TDRD20B; URLC1"
                     /coded_by="NM_016018.4:326..3379"
                     /note="isoform 1 is encoded by transcript variant 1"
                     /db_xref="CCDS:CCDS6367.2"
                     /db_xref="GeneID:51105"
                     /db_xref="HGNC:HGNC:24280"
ORIGIN     
        1 mskkppnrpg itfeigarle aldylqkwyp sriekidyee gkmlvhferw shrydewiyw
       61 dsnrlrpler palrkeglkd eedffdfkag eevlarwtdc ryypakieai nkegtftvqf
      121 ydgvirclkr mhikampeda kgqvksqhpl swccpidpag scnqsmgsed wialvkaaaa
      181 aaaknktgsk prtsansnkd kdkderkwfk vpskkeetst ciatpdvekk edlptssetf
      241 glhvenvpkm vfpqpestls nkrknnqgns fqakrarlnk itgllaskav gvdgaekked
      301 ynetapmleq aispkpqsqk kneadisssa ntqkpallss tlssgkarsk kckhesgdss
      361 gcikppkspl speliqvedl tlvsqlsssv inktsppqpv npprpfkhse rrrrsqrlat
      421 lpmpddsvek vsspspatdg kvfsissqnq qessvpevpd vahlpleklg pclpldlsrg
      481 sevtapvasd ssyrnecpra ekedtqmlpn psskaiadgr gapaaagisk tekkvkledk
      541 sstafgkrke kdkerrekrd kdhyrpkqkk kkkkkkkskq hdysdyedss leflercssp
      601 ltrssgssla srsmftektt tyqyprails vdlsgenlsd vdflddsste slllsgdeyn
      661 qdfdstnfee sqdeddalne ivrcicemde engfmiqcee clcwqhsvcm glleesipeq
      721 yicyicrdpp gqrwsakyry dkewlnngrm cglsffkeny shlnakkivs thhlladvyg
      781 vtevlhglql kigilknkhh pdlhlwacsg krkdqdqiia gvekkiaqdt vnreekkyvq
      841 nhkepprlpl kmegtyitse hsyqkpqsfg qdcksladpg ssddddvssl eeeqefhmrs
      901 knslqysake hgmpeknpae gntvfvyndk kgtedpgdsh lqwqlnllth ienvqnevts
      961 rmdliekevd vleswldftg eleppdplar lpqlkrhikq llidmgkvqq iatlcsv
//

332

Re: Формы, механизмы, энергия наномира - 84

https://www.ncbi.nlm.nih.gov/nuccore/111120330

Homo sapiens PHD finger protein 20-like 1 (PHF20L1), transcript variant 1, mRNA
NCBI Reference Sequence: NM_016018.4
FASTA Graphics
Go to:
LOCUS       NM_016018               6263 bp    mRNA    linear   PRI 15-MAR-2015
DEFINITION  Homo sapiens PHD finger protein 20-like 1 (PHF20L1), transcript
            variant 1, mRNA.
ACCESSION   NM_016018
VERSION     NM_016018.4
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 6263)
  AUTHORS   Esteve PO, Terragni J, Deepti K, Chin HG, Dai N, Espejo A, Correa
            IR Jr, Bedford MT and Pradhan S.
  TITLE     Methyllysine reader plant homeodomain (PHD) finger protein 20-like
            1 (PHF20L1) antagonizes DNA (cytosine-5) methyltransferase 1
            (DNMT1) proteasomal degradation
  JOURNAL   J. Biol. Chem. 289 (12), 8277-8287 (2014)
   PUBMED   24492612
  REMARK    GeneRIF: Malignant brain tumor domain of PHF20L1 reads and controls
            enzyme levels of methylated DNMT1 in cells, thus representing a
            novel antagonist of DNMT1 degradation.
REFERENCE   2  (bases 1 to 6263)
  AUTHORS   Kim J, Daniel J, Espejo A, Lake A, Krishna M, Xia L, Zhang Y and
            Bedford MT.
  TITLE     Tudor, MBT and chromo domains gauge the degree of lysine
            methylation
  JOURNAL   EMBO Rep. 7 (4), 397-403 (2006)
   PUBMED   16415788
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            DB498348.1, BC002822.2, DA196349.1, AK057961.1 and AF230666.2.
            On Aug 3, 2006 this sequence version replaced gi:39653326.
           
            Transcript Variant: This variant (1) represents the longest
            transcript and it encodes the longest protein (isoform 1).
           
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMEA1965299,
                              SAMEA1966682 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-288               DB498348.1         11-298
            289-1927            BC002822.2         247-1885
            1928-1986           DA196349.1         1-59
            1987-4284           AK057961.1         1-2298
            4285-6263           AF230666.2         45678-47656
FEATURES             Location/Qualifiers
     source          1..6263
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="8"
                     /map="8q24.22"
     gene            1..6263
                     /gene="PHF20L1"
                     /gene_synonym="CGI-72; TDRD20B; URLC1"
                     /note="PHD finger protein 20-like 1"
                     /db_xref="GeneID:51105"
                     /db_xref="HGNC:HGNC:24280"
     exon            1..288
                     /gene="PHF20L1"
                     /gene_synonym="CGI-72; TDRD20B; URLC1"
                     /inference="alignment:Splign:1.39.8"
     exon            289..408
                     /gene="PHF20L1"
                     /gene_synonym="CGI-72; TDRD20B; URLC1"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    314..316
                     /gene="PHF20L1"
                     /gene_synonym="CGI-72; TDRD20B; URLC1"
                     /note="upstream in-frame stop codon"
     CDS             326..3379
                     /gene="PHF20L1"
                     /gene_synonym="CGI-72; TDRD20B; URLC1"
                     /note="isoform 1 is encoded by transcript variant 1; PHD
                     finger protein 20-like protein 1; tudor domain-containing
                     protein PHF20L1; tudor domain containing 20B; up-regulated
                     in lung cancer 1"
                     /codon_start=1
                     /product="PHD finger protein 20-like protein 1 isoform 1"
                     /protein_id="NP_057102.4"
                     /db_xref="CCDS:CCDS6367.2"
                     /db_xref="GeneID:51105"
                     /db_xref="HGNC:HGNC:24280"
                     /translation="MSKKPPNRPGITFEIGARLEALDYLQKWYPSRIEKIDYEEGKML
                     VHFERWSHRYDEWIYWDSNRLRPLERPALRKEGLKDEEDFFDFKAGEEVLARWTDCRY
                     YPAKIEAINKEGTFTVQFYDGVIRCLKRMHIKAMPEDAKGQVKSQHPLSWCCPIDPAG
                     SCNQSMGSEDWIALVKAAAAAAAKNKTGSKPRTSANSNKDKDKDERKWFKVPSKKEET
                     STCIATPDVEKKEDLPTSSETFGLHVENVPKMVFPQPESTLSNKRKNNQGNSFQAKRA
                     RLNKITGLLASKAVGVDGAEKKEDYNETAPMLEQAISPKPQSQKKNEADISSSANTQK
                     PALLSSTLSSGKARSKKCKHESGDSSGCIKPPKSPLSPELIQVEDLTLVSQLSSSVIN
                     KTSPPQPVNPPRPFKHSERRRRSQRLATLPMPDDSVEKVSSPSPATDGKVFSISSQNQ
                     QESSVPEVPDVAHLPLEKLGPCLPLDLSRGSEVTAPVASDSSYRNECPRAEKEDTQML
                     PNPSSKAIADGRGAPAAAGISKTEKKVKLEDKSSTAFGKRKEKDKERREKRDKDHYRP
                     KQKKKKKKKKKSKQHDYSDYEDSSLEFLERCSSPLTRSSGSSLASRSMFTEKTTTYQY
                     PRAILSVDLSGENLSDVDFLDDSSTESLLLSGDEYNQDFDSTNFEESQDEDDALNEIV
                     RCICEMDEENGFMIQCEECLCWQHSVCMGLLEESIPEQYICYICRDPPGQRWSAKYRY
                     DKEWLNNGRMCGLSFFKENYSHLNAKKIVSTHHLLADVYGVTEVLHGLQLKIGILKNK
                     HHPDLHLWACSGKRKDQDQIIAGVEKKIAQDTVNREEKKYVQNHKEPPRLPLKMEGTY
                     ITSEHSYQKPQSFGQDCKSLADPGSSDDDDVSSLEEEQEFHMRSKNSLQYSAKEHGMP
                     EKNPAEGNTVFVYNDKKGTEDPGDSHLQWQLNLLTHIENVQNEVTSRMDLIEKEVDVL
                     ESWLDFTGELEPPDPLARLPQLKRHIKQLLIDMGKVQQIATLCSV"
     misc_feature    3050..3052
                     /gene="PHF20L1"
                     /gene_synonym="CGI-72; TDRD20B; URLC1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="N6-acetyllysine. {ECO:0000269|PubMed:19608861};
                     propagated from UniProtKB/Swiss-Prot (A8MW92.2);
                     acetylation site"
     exon            409..580
                     /gene="PHF20L1"
                     /gene_synonym="CGI-72; TDRD20B; URLC1"
                     /inference="alignment:Splign:1.39.8"
     exon            581..665
                     /gene="PHF20L1"
                     /gene_synonym="CGI-72; TDRD20B; URLC1"
                     /inference="alignment:Splign:1.39.8"
     exon            666..754
                     /gene="PHF20L1"
                     /gene_synonym="CGI-72; TDRD20B; URLC1"
                     /inference="alignment:Splign:1.39.8"
     exon            755..832
                     /gene="PHF20L1"
                     /gene_synonym="CGI-72; TDRD20B; URLC1"
                     /inference="alignment:Splign:1.39.8"
     exon            833..1046
                     /gene="PHF20L1"
                     /gene_synonym="CGI-72; TDRD20B; URLC1"
                     /inference="alignment:Splign:1.39.8"
     exon            1047..1172
                     /gene="PHF20L1"
                     /gene_synonym="CGI-72; TDRD20B; URLC1"
                     /inference="alignment:Splign:1.39.8"
     exon            1173..1255
                     /gene="PHF20L1"
                     /gene_synonym="CGI-72; TDRD20B; URLC1"
                     /inference="alignment:Splign:1.39.8"
     exon            1256..1508
                     /gene="PHF20L1"
                     /gene_synonym="CGI-72; TDRD20B; URLC1"
                     /inference="alignment:Splign:1.39.8"
     exon            1509..1697
                     /gene="PHF20L1"
                     /gene_synonym="CGI-72; TDRD20B; URLC1"
                     /inference="alignment:Splign:1.39.8"
     exon            1698..1904
                     /gene="PHF20L1"
                     /gene_synonym="CGI-72; TDRD20B; URLC1"
                     /inference="alignment:Splign:1.39.8"
     STS             1715..1883
                     /gene="PHF20L1"
                     /gene_synonym="CGI-72; TDRD20B; URLC1"
                     /standard_name="RH91375"
                     /db_xref="UniSTS:92387"
     exon            1905..1961
                     /gene="PHF20L1"
                     /gene_synonym="CGI-72; TDRD20B; URLC1"
                     /inference="alignment:Splign:1.39.8"
     exon            1962..2069
                     /gene="PHF20L1"
                     /gene_synonym="CGI-72; TDRD20B; URLC1"
                     /inference="alignment:Splign:1.39.8"
     exon            2070..2234
                     /gene="PHF20L1"
                     /gene_synonym="CGI-72; TDRD20B; URLC1"
                     /inference="alignment:Splign:1.39.8"
     exon            2235..2416
                     /gene="PHF20L1"
                     /gene_synonym="CGI-72; TDRD20B; URLC1"
                     /inference="alignment:Splign:1.39.8"
     exon            2417..2516
                     /gene="PHF20L1"
                     /gene_synonym="CGI-72; TDRD20B; URLC1"
                     /inference="alignment:Splign:1.39.8"
     exon            2517..2712
                     /gene="PHF20L1"
                     /gene_synonym="CGI-72; TDRD20B; URLC1"
                     /inference="alignment:Splign:1.39.8"
     exon            2713..3073
                     /gene="PHF20L1"
                     /gene_synonym="CGI-72; TDRD20B; URLC1"
                     /inference="alignment:Splign:1.39.8"
     exon            3074..3236
                     /gene="PHF20L1"
                     /gene_synonym="CGI-72; TDRD20B; URLC1"
                     /inference="alignment:Splign:1.39.8"
     exon            3237..6263
                     /gene="PHF20L1"
                     /gene_synonym="CGI-72; TDRD20B; URLC1"
                     /inference="alignment:Splign:1.39.8"
     STS             3839..3982
                     /gene="PHF20L1"
                     /gene_synonym="CGI-72; TDRD20B; URLC1"
                     /standard_name="RH99088"
                     /db_xref="UniSTS:84358"
     STS             4063..4180
                     /gene="PHF20L1"
                     /gene_synonym="CGI-72; TDRD20B; URLC1"
                     /standard_name="SHGC-57992"
                     /db_xref="UniSTS:73146"
     STS             5983..6251
                     /gene="PHF20L1"
                     /gene_synonym="CGI-72; TDRD20B; URLC1"
                     /standard_name="WI-21611"
                     /db_xref="UniSTS:78701"
     STS             5983..6167
                     /gene="PHF20L1"
                     /gene_synonym="CGI-72; TDRD20B; URLC1"
                     /standard_name="RH98327"
                     /db_xref="UniSTS:85055"
ORIGIN     
        1 gctgacgtcg ccggggcccg gcgtcgcgtc agggctggcc ggcggcggag gcggcggcgg
       61 cggcggcgat ggcagcggac cctgagcgag cttgagggct cggacccagc tccctcccgc
      121 gaaaccttgg gcggatccgg cgctgcggcc ccagctcgct ccgctcctgc tccctccccg
      181 gccgctgcct gggcggaggc agaggcagag gcccgggctg gccgccctgc tcgtgcccca
      241 gctcggcccc ggacggcccg gctgctgtgc agagaggagg ccgagtcggt agtgaaaaga
      301 gaatactgaa gaataggatc tcaagatgag taaaaagccc ccaaatcgcc ctggaatcac
      361 ttttgagatt ggtgctcgtt tggaggcact ggactactta caaaaatggt atccatcacg
      421 aattgaaaaa attgactatg aggagggcaa gatgttggtc cattttgagc gctggagtca
      481 tcgttatgat gagtggattt actgggatag caatagattg cgaccccttg agagaccagc
      541 actaagaaaa gaagggctaa aagatgagga agatttcttt gattttaaag ctggagaaga
      601 agttctggct cgttggacag actgtcgcta ttaccctgcc aagattgaag caattaacaa
      661 agaaggaaca tttacagttc agttttatga tggagtaatt cgttgtttaa aaagaatgca
      721 cattaaagcc atgcccgagg atgctaaggg gcaggtgaaa tcccagcatc cactaagctg
      781 gtgttgtcct atcgacccag ctggatcgtg taaccagtct atgggaagtg aggattggat
      841 agctttagtc aaagcagctg ctgcagctgc agccaagaac aaaacaggga gtaaacctcg
      901 aaccagcgct aacagcaata aagataagga taaagatgag agaaagtggt ttaaagtacc
      961 ttcaaagaag gaggaaactt caacttgtat agccacacca gacgtagaga agaaggaaga
     1021 tctgcctaca tctagtgaaa catttggact tcatgtagag aacgttccaa agatggtctt
     1081 tccacagcca gagagcacat tatcaaacaa gaggaaaaat aatcaaggca actcgtttca
     1141 ggcaaagaga gctcgactta acaagattac tggtttgttg gcatccaaag ctgttggggt
     1201 tgatggtgct gaaaaaaagg aagactacaa tgaaacagct ccaatgctgg agcaggcgat
     1261 ttcacctaaa cctcaaagtc agaaaaaaaa tgaagctgac attagcagtt ctgccaacac
     1321 tcagaaacct gcactgttat cctcaacttt gtcttcaggg aaggctcgca gcaagaaatg
     1381 caaacatgaa tctggagatt cttctgggtg tataaaaccc cctaaatcac cactttcccc
     1441 agaattaata caagtcgagg atttgacgct tgtatctcag ctttcttctt cagtgataaa
     1501 taaaactagt cctccacagc ctgtgaatcc ccctagacct ttcaagcata gtgagcggag
     1561 aagaagatct cagcgtttag ccaccttacc catgcctgat gattctgtag aaaaggtttc
     1621 ttctccctct ccagccactg atgggaaagt attctccatc agttctcaaa atcagcaaga
     1681 atcttcagta ccagaggtgc ctgatgttgc acatttgcca cttgagaagc tgggaccctg
     1741 tctccctctt gacttaagtc gtggttcaga agttacagca ccggtagcct cagattcctc
     1801 ttaccgtaat gaatgtccca gggcagaaaa agaggataca cagatgcttc caaatccttc
     1861 ttccaaagca atagctgatg gaagaggagc tccagcagca gcaggaatat cgaaaacaga
     1921 aaaaaaagtg aaattggaag acaaaagctc aacagcattt ggtaagagaa aagaaaaaga
     1981 taaggaaaga agagagaaga gagacaaaga tcactacaga ccaaaacaga agaagaagaa
     2041 aaaaaagaaa aagaaatcta agcaacatga ctattcagac tatgaagaca gttccctcga
     2101 atttttggaa aggtgctctt ctccactaac tcgatcttct gggagttctc tggcttcacg
     2161 aagcatgttt acggagaaaa ctacaaccta tcagtaccca agggcaattc tatccgttga
     2221 tcttagtggt gaaaacttat cagatgtaga cttcctagat gattcttcaa cggagagttt
     2281 gcttctgagt ggggatgaat acaatcagga ctttgattca accaattttg aggaatctca
     2341 ggatgaggat gatgctctta atgaaattgt gcgatgtatt tgtgagatgg atgaggagaa
     2401 tggcttcatg atccagtgtg aagagtgctt gtgttggcaa cacagcgtgt gcatggggct
     2461 gctggaggag agcattccag agcagtacat ctgctatatc tgccgggacc caccaggtca
     2521 gaggtggagt gcaaaatatc gttatgataa ggagtggttg aataatggga gaatgtgcgg
     2581 gttatcattt ttcaaagaaa attattctca tctcaatgcc aaaaagatag tttctacaca
     2641 tcacctgctt gctgatgtct atggtgttac agaagtgcta cacgggctac agctgaagat
     2701 tggaatacta aagaataaac atcatcctga ccttcatctc tgggcttgtt ccgggaagcg
     2761 aaaagaccaa gatcaaataa tagctggggt ggagaaaaaa atagctcaag acacagttaa
     2821 tcgagaagaa aagaaatatg tacagaacca taaagaacca cctcgtttgc ccctaaaaat
     2881 ggaaggaact tatataacaa gtgagcatag ctatcaaaag ccacaaagtt ttggtcagga
     2941 ctgtaaatct ctcgcagacc ctgggagctc agatgatgat gatgttagta gtttggaaga
     3001 agaacaagaa ttccacatga gaagtaaaaa cagtttacag tactcagcaa aagaacatgg
     3061 aatgcctgaa aagaatccag ctgaagggaa tacagtattt gtttataatg ataaaaaggg
     3121 caccgaagac ccaggagact cacatcttca gtggcagctc aatctcctta cacacataga
     3181 aaatgtgcag aacgaagtta ccagcaggat ggacctaata gaaaaagaag tcgatgttct
     3241 ggaaagctgg cttgatttca caggggagtt ggagccacca gatcctcttg caagattgcc
     3301 ccaacttaaa cgccacataa aacagctcct aattgacatg ggcaaagtac agcagatagc
     3361 aactctttgc tctgtatgac aacagtgaac acttaatgaa agaatgtggc tttcttcagt
     3421 caaagcattt ttattatcca cgtgatggct aagtggataa tttaaaagct tagtaatgtc
     3481 tggtcattca ctgatttgtg atgtcaatag gatggcacct tggaaagaaa aatgaagaac
     3541 aactttatca aggaagctag tatttaaaaa caaattcatg agcaagctgc aaatgagaat
     3601 gtgttatatg ccaaggaaca atgaagtaga atataatgta tactaaggga tttcaagttc
     3661 tcagaatttt tgagtagttg cttacgtgaa gctcaagata cctgtagaaa gaaatatggt
     3721 atatttgtat agtttttaat agaaagatct atgtttataa accagcactt ggccaaaaac
     3781 aaaattgtaa aggaaattta aattctggag aattctacag ggttgctcta agaactgtct
     3841 tctcagcagt tgatccagct gtacggaaat ttagggtatt taaactttta aaggatcatg
     3901 agctgtttct tgggcgatga atgttctcaa tcagaaaact gacagtagaa atctcacttc
     3961 tggggaaaac agttgtggaa ttcttacttc attatgaatg tatttaaaaa acaaacacca
     4021 aataattgga atatattgca ggcattaagc tcattaaaaa caaactggct tgcagaaggg
     4081 tccgatgtgc caagtgatca tgattctgct ggaaagagga ttttaaatat tgtgggagtt
     4141 ctcccaccct aagtcttaca taatgccacc agtccatcca aaacctatat atcacctata
     4201 ctatatatat catatatata gttgaatggc agtattcagg ctcaacgtac agtttgatcc
     4261 tgagtatgct tggtgtttgc cttcagaaaa aaaaaaatac attgtaaata acctcagctg
     4321 ggatgaggag tgacagaata tcaaaataat ttgtggctgt ggattttttt aactgctagt
     4381 agtggaatac tggaaaagct tcatttctga agatgaattt tatttttaaa aaatacatgc
     4441 acactcaaaa cttttagctt tgatcacaag tggacaaatt tctgaaacca aaggcaacta
     4501 agttgctgtg ttagctcttg ctggattttg agcctaggtc ctactgtctg ccagtactca
     4561 tgtgagttgt atgtgccccc agtgctacat acgcaggtat gcgtaagtgt gtatgcttgt
     4621 tttaaacaaa cactcaacgt acatatgtac ataatctaca catatttata tcacatatct
     4681 agttttatta ctatagacta tacgaattgg tggttaacat gaaatgttac cttttaacag
     4741 actgttttta aaaattaaaa atgtatgtat aggttttgaa atttttttaa aaggggagaa
     4801 agactgttaa gaggaggcta tttgatgaca taacacttga atattttatg cctcattctg
     4861 tttatcagtt ctcgcaatct gtataaatgc attttagaac tgatagacag taaacttgaa
     4921 tttatctttg ataagaatac atgccactgt acattcagat attatttaaa tttgcaaaca
     4981 cattgttcta tatgtaaggg tactgtatgt aaaactctgt attaaaacta ttccacatat
     5041 cctaaaattt cagcttgcct ttttgcggcc ttatattttg atgtaaagat taaaagaatg
     5101 tgcaaaacag tcagaaattt ttattgcctt ttgagattct ccaacttgac aaatgtgcca
     5161 aagatcaaca gacagaaaat atcatcctgt gtatttactt gtcatacttt aactttgtga
     5221 aagatcttac tgataaatga aaagctttag cagaggtggt attgtggggt aattgcttaa
     5281 atttacatat caaagtaaaa aagtagtgcc tgtattccat gtgtggagta aatttgctaa
     5341 tgtctatatt ttatgattga tactattatt tttcctttgc attttaaaat agtggctcta
     5401 atattttccc tgtcatggct acattctaga cattgaattt atatcttctt tttttcagat
     5461 acggagcaaa tagcatcctt aacctatgaa taatggtgtt gcctagattc ttgtcacaca
     5521 cacagaagac cctttgtacc tagtaacatt catcctcttg attcctggtg aacacggtta
     5581 aattcatgca catttgttct tgtagtttct aaaaattaga tcaatttatt tgttagccag
     5641 caaattgaaa attccattat tagattaatg aaatttttgc tctgcttata tgtatacgaa
     5701 ctggaaatct gaatttttaa atttagatct ttaaatcaaa ttatttttat gcatattttc
     5761 atttaatata gagtatacca atcgattgaa gcctttcaca agtagtgcgc tgagcttttc
     5821 ttattgaaga gagtgaatta gtttctgaga agtcagtcta ttgtgaaaag tttcagatga
     5881 gattattttc ttttagtctt tttaaatatc actatatgta tttaaataga agcaataaac
     5941 tagagagagt gtttcttgaa aagacaatgt tttatttgcc accaggcaga acagaatgag
     6001 cattggtaga gaaggctccc tcttggtatg ttactgataa acttgtactt cctcatactt
     6061 gtttgtggtt ctactgactt atttccaaac ttaagagtaa tgtacttcga aaacaacttg
     6121 gttattcttt aaatttcagg taaaacccct tttcctaaca ctcatcttat ttccactgtc
     6181 ttatttcctc tcagatgttc atatttcaca tgttcaaaat gaagcgtact atttcccctc
     6241 caataaacga agtctcctgc caa
//

333

Re: Формы, механизмы, энергия наномира - 84

https://www.ncbi.nlm.nih.gov/nuccore/111120330

FT CDS 326..3379
        1 gctgacgtcg ccggggcccg gcgtcgcgtc agggctggcc ggcggcggag gcggcggcgg
       61 cggcggcgat ggcagcggac cctgagcgag cttgagggct cggacccagc tccctcccgc
      121 gaaaccttgg gcggatccgg cgctgcggcc ccagctcgct ccgctcctgc tccctccccg
      181 gccgctgcct gggcggaggc agaggcagag gcccgggctg gccgccctgc tcgtgcccca
      241 gctcggcccc ggacggcccg gctgctgtgc agagaggagg ccgagtcggt agtgaaaaga
      301 gaatactgaa gaataggatc tcaagatgag taaaaagccc ccaaatcgcc ctggaatcac
      361 ttttgagatt ggtgctcgtt tggaggcact ggactactta caaaaatggt atccatcacg
      421 aattgaaaaa attgactatg aggagggcaa gatgttggtc cattttgagc gctggagtca
      481 tcgttatgat gagtggattt actgggatag caatagattg cgaccccttg agagaccagc
      541 actaagaaaa gaagggctaa aagatgagga agatttcttt gattttaaag ctggagaaga
      601 agttctggct cgttggacag actgtcgcta ttaccctgcc aagattgaag caattaacaa
      661 agaaggaaca tttacagttc agttttatga tggagtaatt cgttgtttaa aaagaatgca
      721 cattaaagcc atgcccgagg atgctaaggg gcaggtgaaa tcccagcatc cactaagctg
      781 gtgttgtcct atcgacccag ctggatcgtg taaccagtct atgggaagtg aggattggat
      841 agctttagtc aaagcagctg ctgcagctgc agccaagaac aaaacaggga gtaaacctcg
      901 aaccagcgct aacagcaata aagataagga taaagatgag agaaagtggt ttaaagtacc
      961 ttcaaagaag gaggaaactt caacttgtat agccacacca gacgtagaga agaaggaaga
     1021 tctgcctaca tctagtgaaa catttggact tcatgtagag aacgttccaa agatggtctt
     1081 tccacagcca gagagcacat tatcaaacaa gaggaaaaat aatcaaggca actcgtttca
     1141 ggcaaagaga gctcgactta acaagattac tggtttgttg gcatccaaag ctgttggggt
     1201 tgatggtgct gaaaaaaagg aagactacaa tgaaacagct ccaatgctgg agcaggcgat
     1261 ttcacctaaa cctcaaagtc agaaaaaaaa tgaagctgac attagcagtt ctgccaacac
     1321 tcagaaacct gcactgttat cctcaacttt gtcttcaggg aaggctcgca gcaagaaatg
     1381 caaacatgaa tctggagatt cttctgggtg tataaaaccc cctaaatcac cactttcccc
     1441 agaattaata caagtcgagg atttgacgct tgtatctcag ctttcttctt cagtgataaa
     1501 taaaactagt cctccacagc ctgtgaatcc ccctagacct ttcaagcata gtgagcggag
     1561 aagaagatct cagcgtttag ccaccttacc catgcctgat gattctgtag aaaaggtttc
     1621 ttctccctct ccagccactg atgggaaagt attctccatc agttctcaaa atcagcaaga
     1681 atcttcagta ccagaggtgc ctgatgttgc acatttgcca cttgagaagc tgggaccctg
     1741 tctccctctt gacttaagtc gtggttcaga agttacagca ccggtagcct cagattcctc
     1801 ttaccgtaat gaatgtccca gggcagaaaa agaggataca cagatgcttc caaatccttc
     1861 ttccaaagca atagctgatg gaagaggagc tccagcagca gcaggaatat cgaaaacaga
     1921 aaaaaaagtg aaattggaag acaaaagctc aacagcattt ggtaagagaa aagaaaaaga
     1981 taaggaaaga agagagaaga gagacaaaga tcactacaga ccaaaacaga agaagaagaa
     2041 aaaaaagaaa aagaaatcta agcaacatga ctattcagac tatgaagaca gttccctcga
     2101 atttttggaa aggtgctctt ctccactaac tcgatcttct gggagttctc tggcttcacg
     2161 aagcatgttt acggagaaaa ctacaaccta tcagtaccca agggcaattc tatccgttga
     2221 tcttagtggt gaaaacttat cagatgtaga cttcctagat gattcttcaa cggagagttt
     2281 gcttctgagt ggggatgaat acaatcagga ctttgattca accaattttg aggaatctca
     2341 ggatgaggat gatgctctta atgaaattgt gcgatgtatt tgtgagatgg atgaggagaa
     2401 tggcttcatg atccagtgtg aagagtgctt gtgttggcaa cacagcgtgt gcatggggct
     2461 gctggaggag agcattccag agcagtacat ctgctatatc tgccgggacc caccaggtca
     2521 gaggtggagt gcaaaatatc gttatgataa ggagtggttg aataatggga gaatgtgcgg
     2581 gttatcattt ttcaaagaaa attattctca tctcaatgcc aaaaagatag tttctacaca
     2641 tcacctgctt gctgatgtct atggtgttac agaagtgcta cacgggctac agctgaagat
     2701 tggaatacta aagaataaac atcatcctga ccttcatctc tgggcttgtt ccgggaagcg
     2761 aaaagaccaa gatcaaataa tagctggggt ggagaaaaaa atagctcaag acacagttaa
     2821 tcgagaagaa aagaaatatg tacagaacca taaagaacca cctcgtttgc ccctaaaaat
     2881 ggaaggaact tatataacaa gtgagcatag ctatcaaaag ccacaaagtt ttggtcagga
     2941 ctgtaaatct ctcgcagacc ctgggagctc agatgatgat gatgttagta gtttggaaga
     3001 agaacaagaa ttccacatga gaagtaaaaa cagtttacag tactcagcaa aagaacatgg
     3061 aatgcctgaa aagaatccag ctgaagggaa tacagtattt gtttataatg ataaaaaggg
     3121 caccgaagac ccaggagact cacatcttca gtggcagctc aatctcctta cacacataga
     3181 aaatgtgcag aacgaagtta ccagcaggat ggacctaata gaaaaagaag tcgatgttct
     3241 ggaaagctgg cttgatttca caggggagtt ggagccacca gatcctcttg caagattgcc
     3301 ccaacttaaa cgccacataa aacagctcct aattgacatg ggcaaagtac agcagatagc
     3361 aactctttgc tctgtatgac aacagtgaac acttaatgaa agaatgtggc tttcttcagt
     3421 caaagcattt ttattatcca cgtgatggct aagtggataa tttaaaagct tagtaatgtc
     3481 tggtcattca ctgatttgtg atgtcaatag gatggcacct tggaaagaaa aatgaagaac
     3541 aactttatca aggaagctag tatttaaaaa caaattcatg agcaagctgc aaatgagaat
     3601 gtgttatatg ccaaggaaca atgaagtaga atataatgta tactaaggga tttcaagttc
     3661 tcagaatttt tgagtagttg cttacgtgaa gctcaagata cctgtagaaa gaaatatggt
     3721 atatttgtat agtttttaat agaaagatct atgtttataa accagcactt ggccaaaaac
     3781 aaaattgtaa aggaaattta aattctggag aattctacag ggttgctcta agaactgtct
     3841 tctcagcagt tgatccagct gtacggaaat ttagggtatt taaactttta aaggatcatg
     3901 agctgtttct tgggcgatga atgttctcaa tcagaaaact gacagtagaa atctcacttc
     3961 tggggaaaac agttgtggaa ttcttacttc attatgaatg tatttaaaaa acaaacacca
     4021 aataattgga atatattgca ggcattaagc tcattaaaaa caaactggct tgcagaaggg
     4081 tccgatgtgc caagtgatca tgattctgct ggaaagagga ttttaaatat tgtgggagtt
     4141 ctcccaccct aagtcttaca taatgccacc agtccatcca aaacctatat atcacctata
     4201 ctatatatat catatatata gttgaatggc agtattcagg ctcaacgtac agtttgatcc
     4261 tgagtatgct tggtgtttgc cttcagaaaa aaaaaaatac attgtaaata acctcagctg
     4321 ggatgaggag tgacagaata tcaaaataat ttgtggctgt ggattttttt aactgctagt
     4381 agtggaatac tggaaaagct tcatttctga agatgaattt tatttttaaa aaatacatgc
     4441 acactcaaaa cttttagctt tgatcacaag tggacaaatt tctgaaacca aaggcaacta
     4501 agttgctgtg ttagctcttg ctggattttg agcctaggtc ctactgtctg ccagtactca
     4561 tgtgagttgt atgtgccccc agtgctacat acgcaggtat gcgtaagtgt gtatgcttgt
     4621 tttaaacaaa cactcaacgt acatatgtac ataatctaca catatttata tcacatatct
     4681 agttttatta ctatagacta tacgaattgg tggttaacat gaaatgttac cttttaacag
     4741 actgttttta aaaattaaaa atgtatgtat aggttttgaa atttttttaa aaggggagaa
     4801 agactgttaa gaggaggcta tttgatgaca taacacttga atattttatg cctcattctg
     4861 tttatcagtt ctcgcaatct gtataaatgc attttagaac tgatagacag taaacttgaa
     4921 tttatctttg ataagaatac atgccactgt acattcagat attatttaaa tttgcaaaca
     4981 cattgttcta tatgtaaggg tactgtatgt aaaactctgt attaaaacta ttccacatat
     5041 cctaaaattt cagcttgcct ttttgcggcc ttatattttg atgtaaagat taaaagaatg
     5101 tgcaaaacag tcagaaattt ttattgcctt ttgagattct ccaacttgac aaatgtgcca
     5161 aagatcaaca gacagaaaat atcatcctgt gtatttactt gtcatacttt aactttgtga
     5221 aagatcttac tgataaatga aaagctttag cagaggtggt attgtggggt aattgcttaa
     5281 atttacatat caaagtaaaa aagtagtgcc tgtattccat gtgtggagta aatttgctaa
     5341 tgtctatatt ttatgattga tactattatt tttcctttgc attttaaaat agtggctcta
     5401 atattttccc tgtcatggct acattctaga cattgaattt atatcttctt tttttcagat
     5461 acggagcaaa tagcatcctt aacctatgaa taatggtgtt gcctagattc ttgtcacaca
     5521 cacagaagac cctttgtacc tagtaacatt catcctcttg attcctggtg aacacggtta
     5581 aattcatgca catttgttct tgtagtttct aaaaattaga tcaatttatt tgttagccag
     5641 caaattgaaa attccattat tagattaatg aaatttttgc tctgcttata tgtatacgaa
     5701 ctggaaatct gaatttttaa atttagatct ttaaatcaaa ttatttttat gcatattttc
     5761 atttaatata gagtatacca atcgattgaa gcctttcaca agtagtgcgc tgagcttttc
     5821 ttattgaaga gagtgaatta gtttctgaga agtcagtcta ttgtgaaaag tttcagatga
     5881 gattattttc ttttagtctt tttaaatatc actatatgta tttaaataga agcaataaac
     5941 tagagagagt gtttcttgaa aagacaatgt tttatttgcc accaggcaga acagaatgag
     6001 cattggtaga gaaggctccc tcttggtatg ttactgataa acttgtactt cctcatactt
     6061 gtttgtggtt ctactgactt atttccaaac ttaagagtaa tgtacttcga aaacaacttg
     6121 gttattcttt aaatttcagg taaaacccct tttcctaaca ctcatcttat ttccactgtc
     6181 ttatttcctc tcagatgttc atatttcaca tgttcaaaat gaagcgtact atttcccctc
     6241 caataaacga agtctcctgc caa
//

Композиционный код:

1,3,3,1,1,2,3,1,3,2,1,3,3,1,3,3,3,3,1,1,2,4,1,1,3,3,3,1,3,2,2,2,3,3,3,3,1,3,1,1,1,1,1,1,1,3,3,1,1,1,3,3,3,3,3,1,1,3,1,1,3,1,3,3,1,2,1,3,1,3
,2,2,2,3,3,3,4,2,3,3,1,3,3,1,3,3,3,3,3,2,3,3,3,4,3,3,1,2,1,3,1,3,1,3,1,1,3,3,2,3,1,3,3,2,2,3,2,3,1,3,3,3,2,2,3,3,3,3,3,3,1,1,3,3,1,1,1,1,3,
3,1,4,1,4,3,1,1,3,2,2,1,1,3,3,3,1,1,2,3,2,4,3,1,1,3,1,2,3,1,3,1,2,3,3,1,3,2,3,3,2,3,2,1,1,1,3,2,4,3,3,3,2,1,1,3,1,1,3,3,3,1,3,3,3,1,3,1,1,3
,3,2,3,2,1,1,1,3,3,2,3,3,2,1,2,2,1,2,1,1,1,3,3,4,3,2,3,3,3,2,3,2,3,3,2,1,1,3,2,1,1,1,3,2,1,2,1,1,2,3,2,1,1,1,3,3,3,3,1,1,4,3,1,2,1,3,3,2,3,
1,1,3,3,3,1,1,2,1,3,3,3,4,3,3,3,3,3,3,1,3,1,1,3,3,2,3,2,1,4,1,1,4,3,2,3,3,3,3,3,1,3,3,3,3,3,1,3,1,3,3,1,1,3,1,3,3,2,4,3,1,2,3,1,3,2,4,1,3,1
,1,1,3,1,3,3,3,3,2,3,3,3,4,3,2,3,1,3,3,2,2,3,1,2,3,3,2,3,1,1,3,1,4,3,2,3,1,3,3,3,2,4,2,3,3,3,3,3,2,1,3,4,3,1,3,3,3,1,1,3,3,1,4,3,3,3,3,1,3,
3,1,1,3,1,1,3,3,3,3,2,3,1,3,3,3,1,3,2,1,3,3,4,3,2,1,1,1,3,3,3,3,1,3,3,3,2,2,2,1,4,3,3,3,2,3,1,2,3,1,1,4,2,1,3,1,3,3,1,3,3,3,3,2,3,3,2,2,4,2
,1,2,3,1,3,1,3,3,3,3,1,1,2,3,3,1,3,2,1,1,3,2,3,3,3,1,3,2,2,3,3,2,3,2,3,2,2,2,2,2,2,4,3,2,3,3,3,4,3,1,3,1,3,1,2,2,2,3,3,1,3,3,3,3,3,1,3,3,3,
1,1,3,1,3,3,1,1,3,2,3,1,1,1,1,3,3,1,3,1,3,3,1,3,3,1,3,2,1,3,3,1,3,1,1,3,3,1,3,1,1,3,3,2,2,3,2,3,3,4,3,3,4,3,2,2,1,1,3,4,1,3,3,2,1,3,1,1,2,1
,2,3,2,1,3,3,3,3,3,3,1,3,2,3,2,1,1,2,3,3,3,2,4,1,3,1,3,4,3,4,3,3,1,3,1,1,3,3,2,1,3,3,1,3,3,1,3,1,3,3,3,3,3,3,3,4,2,3,3,3,1,1,3,1,1,3,1,1,1,
1,1,3,3,1,1,1,3,1,3,1,1,4,1,1,4,4,4,1,1,1,3,2,1,1,1,1,1,3,1,1,4,1,2,2,3,1,1,1,3,2,3,3,3,3,3,1,1,1,1,3,3,4,3,1,1,4,3,2,3,1,3,3,3,3,3,3,1,3,1
,3,1,2,3,3,2,3,1,4,3,3,3,1,3,3,3,2,3,4,2,1,4,2,1,4,1,3,2,2,2,1,3,3,3,3,3,1,3,3,1,1,3,3,1,4,1,2,3,1,3,3,3,2,2,3,4,4,1,3,3,2,3,3,1,2,3,3,2,3,
3,1,3,3,2,1,1,3,3,3,2,3,3,1,1,2,3,1,3,2,3,3,2,2,3,1,3,1,3,3,1,2,3,3,3,3,1,1,3,3,3,1,2,1,3,4,1,2,3,3,3,3,3,3,3,1,3,3,3,3,3,1,1,1,3,3,3,1,3,3
,1,1,2,2,3,3,3,2,1,3,3,1,3,2,3,3,4,3,2,2,3,3,3,3,3,3,1,1,1,3,1,2,2,1,2,3,3,1,1,1,1,3,1,3,2,1,2,3,3,4,1,1,3,3,1,1,1,1,1,2,2,3,3,3,1,3,3,4,3,
1,1,3,3,1,2,4,1,1,1,2,2,3,3,3,2,3,1,1,3,3,3,1,1,2,3,1,1,2,3,1,1,1,3,2,1,1,2,2,3,3,1,3,

Вторичная структура (Пикотех): https://img-fotki.yandex.ru/get/196161/ … 2_orig.gif

https://img-fotki.yandex.ru/get/172931/158289418.3bd/0_17012f_d1dd6f68_orig.png

https://img-fotki.yandex.ru/get/47175/158289418.3bd/0_170130_b080766d_orig.png

https://img-fotki.yandex.ru/get/172931/158289418.3bd/0_170131_7ce751d4_orig.png
Полилизин образовал совсем другую структуру...

https://img-fotki.yandex.ru/get/113961/158289418.3be/0_170132_99c0b3c6_orig.png
Полиаргинин

334

Re: Формы, механизмы, энергия наномира - 84

Кушелев: А где же полилизиновые "хвосты"? smile

335

Re: Формы, механизмы, энергия наномира - 84

https://www.ncbi.nlm.nih.gov/protein/22 … C0A790J015

protein LYRIC [Homo sapiens]
NCBI Reference Sequence: NP_848927.2
Identical Proteins FASTA Graphics
Go to:
LOCUS       NP_848927                582 aa            linear   PRI 15-MAR-2015
DEFINITION  protein LYRIC [Homo sapiens].
ACCESSION   NP_848927
VERSION     NP_848927.2
DBSOURCE    REFSEQ: accession NM_178812.3
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (residues 1 to 582)
  AUTHORS   Xia X, Du R, Zhao L, Sun W and Wang X.
  TITLE     Expression of AEG-1 and microvessel density correlates with
            metastasis and prognosis of oral squamous cell carcinoma
  JOURNAL   Hum. Pathol. 45 (4), 858-865 (2014)
   PUBMED   24656097
  REMARK    GeneRIF: Expression of AEG-1 may be correlated with tumor
            angiogenesis and metastasis and is a valuable prognostic factor in
            patients with oral squamous cell carcinoma
REFERENCE   2  (residues 1 to 582)
  AUTHORS   Zheng J, Li C, Wu X, Yang Y, Hao M, Sheng S, Sun Y, Zhang H, Long J
            and Hu C.
  TITLE     Astrocyte elevated gene-1 is a novel biomarker of
            epithelial-mesenchymal transition and progression of hepatocellular
            carcinoma in two China regions
  JOURNAL   Tumour Biol. 35 (3), 2265-2269 (2014)
   PUBMED   24136747
  REMARK    GeneRIF: These findings suggest that AEG-1 may be an
            epithelial-mesenchymal transition-associated biomarker in human
            hepatocellular carcinoma and play important roles in the
            progression of hepatocellular carcinoma
REFERENCE   3  (residues 1 to 582)
  AUTHORS   Huang S, Wu B, Li D, Zhou W, Deng G, Zhang K and Li Y.
  TITLE     Knockdown of astrocyte elevated gene-1 inhibits tumor growth and
            modifies microRNAs expression profiles in human colorectal cancer
            cells
  JOURNAL   Biochem. Biophys. Res. Commun. 444 (3), 338-345 (2014)
   PUBMED   24462870
  REMARK    GeneRIF: Targeted inhibition of AEG-1 can lead to modification of
            key elemental characteristics, such as miRNAs, which may become a
            potential effective therapeutic strategy for CRC
REFERENCE   4  (residues 1 to 582)
  AUTHORS   Ran C, Graae L, Magnusson PK, Pedersen NL, Olson L and Belin AC.
  TITLE     A replication study of GWAS findings in migraine identifies
            association in a Swedish case-control sample
  JOURNAL   BMC Med. Genet. 15, 38 (2014)
   PUBMED   24674449
  REMARK    GeneRIF: An association between MTDH rs1835740 SNP and migraine in
            a Swedish case-control study.
            Publication Status: Online-Only
REFERENCE   5  (residues 1 to 582)
  AUTHORS   Wang YP, Liu IJ, Chiang CP and Wu HC.
  TITLE     Astrocyte elevated gene-1 is associated with metastasis in head and
            neck squamous cell carcinoma through p65 phosphorylation and
            upregulation of MMP1
  JOURNAL   Mol. Cancer 12 (1), 109 (2013)
   PUBMED   24063540
  REMARK    GeneRIF: AEG-1 increases phosphorylation of the p65 subunit of
            NF-kappaB, and regulates the expression of MMP1 in head and neck
            squamous cell carcinoma cells.
            Publication Status: Online-Only
REFERENCE   6  (residues 1 to 582)
  AUTHORS   Emdad L, Sarkar D, Su ZZ, Randolph A, Boukerche H, Valerie K and
            Fisher PB.
  TITLE     Activation of the nuclear factor kappaB pathway by astrocyte
            elevated gene-1: implications for tumor progression and metastasis
  JOURNAL   Cancer Res. 66 (3), 1509-1516 (2006)
   PUBMED   16452207
REFERENCE   7  (residues 1 to 582)
  AUTHORS   Kang DC, Su ZZ, Sarkar D, Emdad L, Volsky DJ and Fisher PB.
  TITLE     Cloning and characterization of HIV-1-inducible astrocyte elevated
            gene-1, AEG-1
  JOURNAL   Gene 353 (1), 8-15 (2005)
   PUBMED   15927426
REFERENCE   8  (residues 1 to 582)
  AUTHORS   Britt DE, Yang DF, Yang DQ, Flanagan D, Callanan H, Lim YP, Lin SH
            and Hixson DC.
  TITLE     Identification of a novel protein, LYRIC, localized to tight
            junctions of polarized epithelial cells
  JOURNAL   Exp. Cell Res. 300 (1), 134-148 (2004)
   PUBMED   15383321
  REMARK    GeneRIF: a novel protein LYRIC is recruited during the maturation
            of the tight junction complex.
REFERENCE   9  (residues 1 to 582)
  AUTHORS   Brown DM and Ruoslahti E.
  TITLE     Metadherin, a cell surface protein in breast tumors that mediates
            lung metastasis
  JOURNAL   Cancer Cell 5 (4), 365-374 (2004)
   PUBMED   15093543
  REMARK    GeneRIF: overexpression of metadherin is associated with metastatic
            breast cancer
REFERENCE   10 (residues 1 to 582)
  AUTHORS   Sutherland HG, Lam YW, Briers S, Lamond AI and Bickmore WA.
  TITLE     3D3/lyric: a novel transmembrane protein of the endoplasmic
            reticulum and nuclear envelope, which is also present in the
            nucleolus
  JOURNAL   Exp. Cell Res. 294 (1), 94-105 (2004)
   PUBMED   14980505
  REMARK    GeneRIF: 3D3/lyric is localized to the membrane of the endoplasmic
            reticulum, nuclear envelope, and the nucleolus.
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BC045642.1, AY082966.1, AF411226.1 and AP003357.2.
            On Feb 13, 2009 this sequence version replaced gi:30520310.
           
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
           
            ##Evidence-Data-START##
            Transcript exon combination :: BC045642.1, AF501310.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA1965299, SAMEA1966682
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..582
                     /organism="Homo sapiens"
                     /db_xref="taxon:9606"
                     /chromosome="8"
                     /map="8q22.1"
     Protein         1..582
                     /product="protein LYRIC"
                     /note="metastasis adhesion protein; 3D3/LYRIC; astrocyte
                     elevated gene-1 protein; lysine-rich CEACAM1 co-isolated
                     protein; astrocyte elevated gene 1"
                     /calculated_mol_wt=63706
     Region          1..71
                     /region_name="Activation of NF-kappa-B"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q86UE4.2)"
     Region          6..422
                     /region_name="LYRIC"
                     /note="Lysine-rich CEACAM1 co-isolated protein family;
                     pfam15686"
                     /db_xref="CDD:292314"
     Site            49..69
                     /site_type="transmembrane region"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q86UE4.2)"
     Region          72..169
                     /region_name="Interaction with BCCIP"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q86UE4.2)"
     Region          101..205
                     /region_name="Interaction with RELA"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q86UE4.2)"
     Site            143
                     /site_type="phosphorylation"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphothreonine; propagated from
                     UniProtKB/Swiss-Prot (Q86UE4.2)"
     Site            298
                     /site_type="phosphorylation"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q86UE4.2)"
     Site            306
                     /site_type="phosphorylation"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q86UE4.2)"
     Site            308
                     /site_type="phosphorylation"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q86UE4.2)"
     Site            311
                     /site_type="phosphorylation"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q86UE4.2)"
     Site            344
                     /site_type="phosphorylation"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q86UE4.2)"
     Site            369
                     /site_type="phosphorylation"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q86UE4.2)"
     Region          381..443
                     /region_name="Lung-homing for mammary tumors (By
                     similarity)"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q86UE4.2)"
     Site            415
                     /site_type="phosphorylation"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q86UE4.2)"
     Site            426
                     /site_type="phosphorylation"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q86UE4.2)"
     Site            458
                     /site_type="phosphorylation"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphothreonine; propagated from
                     UniProtKB/Swiss-Prot (Q86UE4.2)"
     Site            568
                     /site_type="phosphorylation"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q86UE4.2)"
     CDS             1..582
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /coded_by="NM_178812.3:329..2077"
                     /db_xref="CCDS:CCDS6274.1"
                     /db_xref="GeneID:92140"
                     /db_xref="HGNC:HGNC:29608"
                     /db_xref="MIM:610323"
ORIGIN     
        1 maarswqdel aqqaeegsar lremlsvglg flrtelgldl glepkrypgw vilvgtgalg
       61 llllfllgyg waaacagark krrspprkre eaaavpaaap ddlallknlr seeqkkknrk
      121 klsekpkpng rtvevaegea vrtpqsvtak qppeidkkne kskknkkksk sdakavqnss
      181 rhdgkevdeg awetkishre krqqrkrdkv ltdsgsldst ipgientitv tteqlttasf
      241 pvgskknkgd shlnvqvsnf ksgkgdstlq vssglnenlt vngggwneks vklssqisag
      301 eekwnsvspa sagkrkteps awsqdtgdan tngkdwgrsw sdrsifsgig staepvsqst
      361 tsdyqwdvsr nqpyiddews glnglssadp nsdwnapaee wgnwvdeera sllksqepip
      421 ddqkvsdddk ekgegalptg kskkkkkkkk kqgednstaq dteelekeir edlpvntskt
      481 rpkqekafsl ktistsdpae vlvknsqpik tlppatstep svilsksdsd ksssqvppil
      541 qetdksksnt kqnsvppsqt ksetswespk qikkkkkarr et
//

336

Re: Формы, механизмы, энергия наномира - 84

https://www.ncbi.nlm.nih.gov/nuccore/223555916

Homo sapiens metadherin (MTDH), mRNA
NCBI Reference Sequence: NM_178812.3
FASTA Graphics
Go to:
LOCUS       NM_178812               7667 bp    mRNA    linear   PRI 15-MAR-2015
DEFINITION  Homo sapiens metadherin (MTDH), mRNA.
ACCESSION   NM_178812
VERSION     NM_178812.3
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 7667)
  AUTHORS   Xia X, Du R, Zhao L, Sun W and Wang X.
  TITLE     Expression of AEG-1 and microvessel density correlates with
            metastasis and prognosis of oral squamous cell carcinoma
  JOURNAL   Hum. Pathol. 45 (4), 858-865 (2014)
   PUBMED   24656097
  REMARK    GeneRIF: Expression of AEG-1 may be correlated with tumor
            angiogenesis and metastasis and is a valuable prognostic factor in
            patients with oral squamous cell carcinoma
REFERENCE   2  (bases 1 to 7667)
  AUTHORS   Zheng J, Li C, Wu X, Yang Y, Hao M, Sheng S, Sun Y, Zhang H, Long J
            and Hu C.
  TITLE     Astrocyte elevated gene-1 is a novel biomarker of
            epithelial-mesenchymal transition and progression of hepatocellular
            carcinoma in two China regions
  JOURNAL   Tumour Biol. 35 (3), 2265-2269 (2014)
   PUBMED   24136747
  REMARK    GeneRIF: These findings suggest that AEG-1 may be an
            epithelial-mesenchymal transition-associated biomarker in human
            hepatocellular carcinoma and play important roles in the
            progression of hepatocellular carcinoma
REFERENCE   3  (bases 1 to 7667)
  AUTHORS   Huang S, Wu B, Li D, Zhou W, Deng G, Zhang K and Li Y.
  TITLE     Knockdown of astrocyte elevated gene-1 inhibits tumor growth and
            modifies microRNAs expression profiles in human colorectal cancer
            cells
  JOURNAL   Biochem. Biophys. Res. Commun. 444 (3), 338-345 (2014)
   PUBMED   24462870
  REMARK    GeneRIF: Targeted inhibition of AEG-1 can lead to modification of
            key elemental characteristics, such as miRNAs, which may become a
            potential effective therapeutic strategy for CRC
REFERENCE   4  (bases 1 to 7667)
  AUTHORS   Ran C, Graae L, Magnusson PK, Pedersen NL, Olson L and Belin AC.
  TITLE     A replication study of GWAS findings in migraine identifies
            association in a Swedish case-control sample
  JOURNAL   BMC Med. Genet. 15, 38 (2014)
   PUBMED   24674449
  REMARK    GeneRIF: An association between MTDH rs1835740 SNP and migraine in
            a Swedish case-control study.
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 7667)
  AUTHORS   Wang YP, Liu IJ, Chiang CP and Wu HC.
  TITLE     Astrocyte elevated gene-1 is associated with metastasis in head and
            neck squamous cell carcinoma through p65 phosphorylation and
            upregulation of MMP1
  JOURNAL   Mol. Cancer 12 (1), 109 (2013)
   PUBMED   24063540
  REMARK    GeneRIF: AEG-1 increases phosphorylation of the p65 subunit of
            NF-kappaB, and regulates the expression of MMP1 in head and neck
            squamous cell carcinoma cells.
            Publication Status: Online-Only
REFERENCE   6  (bases 1 to 7667)
  AUTHORS   Emdad L, Sarkar D, Su ZZ, Randolph A, Boukerche H, Valerie K and
            Fisher PB.
  TITLE     Activation of the nuclear factor kappaB pathway by astrocyte
            elevated gene-1: implications for tumor progression and metastasis
  JOURNAL   Cancer Res. 66 (3), 1509-1516 (2006)
   PUBMED   16452207
REFERENCE   7  (bases 1 to 7667)
  AUTHORS   Kang DC, Su ZZ, Sarkar D, Emdad L, Volsky DJ and Fisher PB.
  TITLE     Cloning and characterization of HIV-1-inducible astrocyte elevated
            gene-1, AEG-1
  JOURNAL   Gene 353 (1), 8-15 (2005)
   PUBMED   15927426
REFERENCE   8  (bases 1 to 7667)
  AUTHORS   Britt DE, Yang DF, Yang DQ, Flanagan D, Callanan H, Lim YP, Lin SH
            and Hixson DC.
  TITLE     Identification of a novel protein, LYRIC, localized to tight
            junctions of polarized epithelial cells
  JOURNAL   Exp. Cell Res. 300 (1), 134-148 (2004)
   PUBMED   15383321
  REMARK    GeneRIF: a novel protein LYRIC is recruited during the maturation
            of the tight junction complex.
REFERENCE   9  (bases 1 to 7667)
  AUTHORS   Brown DM and Ruoslahti E.
  TITLE     Metadherin, a cell surface protein in breast tumors that mediates
            lung metastasis
  JOURNAL   Cancer Cell 5 (4), 365-374 (2004)
   PUBMED   15093543
  REMARK    GeneRIF: overexpression of metadherin is associated with metastatic
            breast cancer
REFERENCE   10 (bases 1 to 7667)
  AUTHORS   Sutherland HG, Lam YW, Briers S, Lamond AI and Bickmore WA.
  TITLE     3D3/lyric: a novel transmembrane protein of the endoplasmic
            reticulum and nuclear envelope, which is also present in the
            nucleolus
  JOURNAL   Exp. Cell Res. 294 (1), 94-105 (2004)
   PUBMED   14980505
  REMARK    GeneRIF: 3D3/lyric is localized to the membrane of the endoplasmic
            reticulum, nuclear envelope, and the nucleolus.
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BC045642.1, AY082966.1, AF411226.1 and AP003357.2.
            On Feb 13, 2009 this sequence version replaced gi:31343604.
           
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
           
            ##Evidence-Data-START##
            Transcript exon combination :: BC045642.1, AF501310.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA1965299, SAMEA1966682
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-559               BC045642.1         1-559
            560-2281            AY082966.1         310-2031
            2282-3720           AF411226.1         2173-3611
            3721-7667           AP003357.2         48208-52154
FEATURES             Location/Qualifiers
     source          1..7667
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="8"
                     /map="8q22.1"
     gene            1..7667
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /note="metadherin"
                     /db_xref="GeneID:92140"
                     /db_xref="HGNC:HGNC:29608"
                     /db_xref="MIM:610323"
     exon            1..709
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    230..232
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /note="upstream in-frame stop codon"
     CDS             329..2077
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /note="metastasis adhesion protein; 3D3/LYRIC; astrocyte
                     elevated gene-1 protein; lysine-rich CEACAM1 co-isolated
                     protein; astrocyte elevated gene 1"
                     /codon_start=1
                     /product="protein LYRIC"
                     /protein_id="NP_848927.2"
                     /db_xref="CCDS:CCDS6274.1"
                     /db_xref="GeneID:92140"
                     /db_xref="HGNC:HGNC:29608"
                     /db_xref="MIM:610323"
                     /translation="MAARSWQDELAQQAEEGSARLREMLSVGLGFLRTELGLDLGLEP
                     KRYPGWVILVGTGALGLLLLFLLGYGWAAACAGARKKRRSPPRKREEAAAVPAAAPDD
                     LALLKNLRSEEQKKKNRKKLSEKPKPNGRTVEVAEGEAVRTPQSVTAKQPPEIDKKNE
                     KSKKNKKKSKSDAKAVQNSSRHDGKEVDEGAWETKISHREKRQQRKRDKVLTDSGSLD
                     STIPGIENTITVTTEQLTTASFPVGSKKNKGDSHLNVQVSNFKSGKGDSTLQVSSGLN
                     ENLTVNGGGWNEKSVKLSSQISAGEEKWNSVSPASAGKRKTEPSAWSQDTGDANTNGK
                     DWGRSWSDRSIFSGIGSTAEPVSQSTTSDYQWDVSRNQPYIDDEWSGLNGLSSADPNS
                     DWNAPAEEWGNWVDEERASLLKSQEPIPDDQKVSDDDKEKGEGALPTGKSKKKKKKKK
                     KQGEDNSTAQDTEELEKEIREDLPVNTSKTRPKQEKAFSLKTISTSDPAEVLVKNSQP
                     IKTLPPATSTEPSVILSKSDSDKSSSQVPPILQETDKSKSNTKQNSVPPSQTKSETSW
                     ESPKQIKKKKKARRET"
     misc_feature    329..541
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q86UE4.2);
                     Region: Activation of NF-kappa-B"
     misc_feature    473..535
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q86UE4.2);
                     transmembrane region"
     misc_feature    542..835
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q86UE4.2);
                     Region: Interaction with BCCIP"
     misc_feature    629..943
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q86UE4.2);
                     Region: Interaction with RELA"
     misc_feature    755..757
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphothreonine; propagated from
                     UniProtKB/Swiss-Prot (Q86UE4.2); phosphorylation site"
     misc_feature    1220..1222
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q86UE4.2); phosphorylation site"
     misc_feature    1244..1246
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q86UE4.2); phosphorylation site"
     misc_feature    1250..1252
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q86UE4.2); phosphorylation site"
     misc_feature    1259..1261
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q86UE4.2); phosphorylation site"
     misc_feature    1358..1360
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q86UE4.2); phosphorylation site"
     misc_feature    1433..1435
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q86UE4.2); phosphorylation site"
     misc_feature    1469..1657
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q86UE4.2);
                     Region: Lung-homing for mammary tumors (By similarity)"
     misc_feature    1571..1573
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q86UE4.2); phosphorylation site"
     misc_feature    1604..1606
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q86UE4.2); phosphorylation site"
     misc_feature    1700..1702
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphothreonine; propagated from
                     UniProtKB/Swiss-Prot (Q86UE4.2); phosphorylation site"
     misc_feature    2030..2032
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q86UE4.2); phosphorylation site"
     exon            710..811
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /inference="alignment:Splign:1.39.8"
     exon            812..896
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /inference="alignment:Splign:1.39.8"
     exon            897..1073
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /inference="alignment:Splign:1.39.8"
     exon            1074..1139
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /inference="alignment:Splign:1.39.8"
     exon            1140..1376
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /inference="alignment:Splign:1.39.8"
     exon            1377..1475
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /inference="alignment:Splign:1.39.8"
     STS             1390..1488
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /standard_name="Mtdh"
                     /db_xref="UniSTS:526938"
     exon            1476..1600
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /inference="alignment:Splign:1.39.8"
     exon            1601..1708
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /inference="alignment:Splign:1.39.8"
     exon            1709..1849
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /inference="alignment:Splign:1.39.8"
     exon            1850..2006
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /inference="alignment:Splign:1.39.8"
     STS             1880..2018
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /standard_name="WI-16602"
                     /db_xref="UniSTS:81622"
     exon            2007..7667
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /inference="alignment:Splign:1.39.8"
     STS             2091..2362
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /standard_name="SGC44379"
                     /db_xref="UniSTS:52637"
     STS             2277..2418
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /standard_name="D8S2022"
                     /db_xref="UniSTS:25486"
     STS             3487..3642
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /standard_name="WIAF-2226"
                     /db_xref="UniSTS:10668"
     STS             3491..3642
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /standard_name="G60024"
                     /db_xref="UniSTS:137290"
     STS             3497..3577
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /standard_name="D8S1676E"
                     /db_xref="UniSTS:153920"
     STS             3499..3641
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /standard_name="RH17796"
                     /db_xref="UniSTS:48584"
     STS             3573..3722
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /standard_name="SHGC-34109"
                     /db_xref="UniSTS:18519"
     STS             4433..4710
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /standard_name="D13S1639"
                     /db_xref="UniSTS:473568"
     STS             4988..5171
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /standard_name="RH45730"
                     /db_xref="UniSTS:20095"
     STS             5142..5221
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /standard_name="D8S1375E"
                     /db_xref="UniSTS:151188"
     STS             6643..6847
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /standard_name="A007D43"
                     /db_xref="UniSTS:40772"
     STS             6830..6967
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /standard_name="D8S1439E"
                     /db_xref="UniSTS:151228"
     STS             6890..7026
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /standard_name="RH69405"
                     /db_xref="UniSTS:61270"
     STS             7445..7667
                     /gene="MTDH"
                     /gene_synonym="3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3"
                     /standard_name="RH36459"
                     /db_xref="UniSTS:74255"
ORIGIN     
        1 ggcccaagcc gccattgttc cgccgaggga ggacagcggg gcctggcgct ggcgccgaga
       61 cgccgcttag cggccgccac tggagacact ccctcccgcc tcccgggtct cctggcggcg
      121 gcggagtgag gctgacagcg gggaacctgg gagacccctc cgccctcccc gcggtggcag
      181 cggccgatcc ccggctccgg cgcgagggac ggccgcgatg cgctcggcct gaggttaccc
      241 ggcccggccc ttcctcgctt ccctcgacta ttccactgcg tctccgcgcc ccggcgtcat
      301 cctgcgagtc cctctgacgg gagggaagat ggctgcacgg agctggcagg acgagctggc
      361 ccagcaggcc gaggagggct cggcccggct gcgggaaatg ctctcggtcg gcctaggctt
      421 tctgcgcacc gagctgggcc tcgacctggg gctggagccg aaacggtacc ccggctgggt
      481 gatcctggtg ggcactggcg cgctcgggct gctgctgctg tttctgctgg gctacggctg
      541 ggccgcggct tgcgccggcg cccgcaaaaa gcggaggagc ccgccccgca agcgggagga
      601 ggcggcggcc gtgccggccg cggcccccga cgacctggcc ttgctgaaga atctccggag
      661 cgaggaacag aagaagaaga accggaagaa actgtccgag aagcccaaac caaatgggcg
      721 gactgttgaa gtggctgagg gtgaagctgt tcgaacacct caaagtgtaa cagcaaagca
      781 gccaccagag attgacaaga aaaatgaaaa gtcaaagaaa aataagaaga aatcaaagtc
      841 agatgctaaa gcagtgcaaa acagttcacg ccatgatgga aaggaagttg atgaaggagc
      901 ctgggaaact aaaattagtc acagagagaa acgacagcag cgtaaacgtg ataaggtgct
      961 gactgattct ggttcattgg attcaactat ccctgggata gaaaatacca tcacagttac
     1021 caccgagcaa cttacaaccg catcatttcc tgttggttcc aagaagaata aaggtgattc
     1081 tcatctaaat gttcaagtta gcaactttaa atctggaaaa ggagattcta cacttcaggt
     1141 ttcttcagga ttgaatgaaa acctcactgt caatggagga ggctggaatg aaaagtctgt
     1201 aaaactctcc tcacagatca gtgcaggtga ggagaagtgg aactccgttt cacctgcttc
     1261 tgcaggaaag aggaaaactg agccatctgc ctggagtcaa gacactggag atgctaatac
     1321 aaatggaaaa gactggggaa ggagttggag tgaccgttca atattttctg gcattgggtc
     1381 tactgctgag ccagtttctc agtctaccac ttctgattat cagtgggatg ttagccgtaa
     1441 tcaaccctat atcgatgatg aatggtctgg gttaaatggt ctgtcttctg ctgatcccaa
     1501 ctctgattgg aatgcaccag cagaagagtg gggcaattgg gtagacgaag aaagagcttc
     1561 acttctaaag tcccaggaac caattcctga tgatcaaaag gtctcagatg atgataaaga
     1621 aaagggagag ggagctcttc caactgggaa atccaaaaag aaaaaaaaga aaaagaagaa
     1681 gcaaggtgaa gataactcta ctgcacagga cacagaagaa ttagaaaaag agattagaga
     1741 agaccttcca gtgaatacct ctaaaacccg tccaaaacag gaaaaagctt tttccttgaa
     1801 gaccataagc actagtgatc cagccgaagt actcgtcaaa aatagccagc ctatcaagac
     1861 tcttccacct gctacttcta ccgagccatc tgtaatctta tcaaaaagtg attctgacaa
     1921 gagctcttcc caagtgccgc caatactaca agagacagat aaatccaagt caaataccaa
     1981 gcaaaatagt gtgcctcctt cacagaccaa gtctgaaact agctgggaat ctcccaaaca
     2041 aataaaaaag aagaaaaaag ccagacgaga aacgtgaaat tttttttcct gaattggaca
     2101 tgtgtttgca aacacttgtc ttgaagatta tgctgtttat gcaataattt gtgaacatgt
     2161 acagagtttt atataaattt aaaccaattt ttaaaacaaa actgcggaca ccaccataaa
     2221 aatggaatca aaagaaagtt aatttatgaa attaagaggt cagcagaata tactcagtga
     2281 tggaagacac ttgggaaagt ctttttaata gaacaagaac gatcttaatt taagaatatt
     2341 atcctggttt aacaacagtg ccctgtttac aacagattgt gccctatctc atctgcagcc
     2401 gaggaataaa ggattctgat tagaaagagg gttgcctaca gattagtaag caattccttg
     2461 gatcttatgc acagaacttg taccatttga atctgtttta tgcttaaatc aaagtgcttt
     2521 gatcaaatgc ataacctgcc atatctttac atatttgttg gtagcaattt gtattaaaga
     2581 aatcacaagt gcaaataaaa agtcatttat catttgttta actaaactgt catggtttag
     2641 tttacaattt ttaaaaagtt cttaaaatac tgaaaatgca gttgacactt gtgtatggct
     2701 tatgaagtta tttttgatag tcttacatta cttgaattgt tcaaagtaca gtatatttta
     2761 aattaagaaa agtgaactat atgtatttgt tttatacatt taaggcttag actcataaat
     2821 aatgctattg tttatgattt gaaaactttc aggcaaaatc caatttacat ttttcccttc
     2881 cctagcaatt acttttttcc agcttcaact cttcttagtt actaatactt tgttgacttt
     2941 aaaaatgaaa tcattcacaa acttttggta tatgatggag aatgaaaaac tagagtcaga
     3001 cagctttaat tgacattgtc aacacctcca gttatcagga atacattttt ttactgcctt
     3061 aacctgtagt gcgtagaata tgcatcaatt tcttgaagga gattcatgtt tttataagaa
     3121 ttttcatgta attattgcaa ttgtggtcaa ataaggaacg tttcctgctt gaaattatat
     3181 tgatttaaat gatgtgtgag atgtttcacc attttcaggc actgtgtaat tctattgtaa
     3241 taaactggca ggtatctttg taactataaa tagtgcatgc tcagccatgt acactgtaaa
     3301 tagcctttac caaacgtgtt tgacaaggac cataattaac atcacttagt gaattgtgat
     3361 aaagaaaaaa aagccatgat ttattcgatg tgattggctt gtttttatgt ggcgccaaga
     3421 acgaacctgt ttaacagctg taaccaatgg tactgatcta tccatccaat gttgtcatta
     3481 tatttgactg tggttcaaca gtattgcgtt gtcagactag gaaagctaaa cgaacaaaat
     3541 ggttttagtt ttgctgaaga ctggccttat taatggacag ctttcctaac aagagattat
     3601 taacttttat caggtgttaa catctgtttc aggaacatgg cagtatgttt acatgtcaga
     3661 agttttgttt aattctatgg tatttctaaa ttgacttgtt taaataaatt cagcaaatgg
     3721 atagcattgt tttttatttg cttcaatatg ggggtagata atagctaaag agccaaggat
     3781 gaatttcttc aaatgacttt attctgttag ctttacatag gtgttggagg attcctaagg
     3841 tgtcagcatt ttgtaaaggt accacaaagg agaagttgat agggaatcta attttagaat
     3901 gtgccaaatg gtctgtgctc aacaatataa ttgaactctc tcaactctac ctcaccattt
     3961 ctttatctca aaattctgtt ggctttgtca aacgttggat tttatttctg cagcctagta
     4021 tctccccatt ctaccaccta tgccagatgt taaagacagc agatgttttg aggagaatgg
     4081 cattgtggag atgcagagat gcgttgctaa gttgaggtgg atccagtata gagatacctc
     4141 tatttcttct ttatggctca agagctagga cttggatttt gttttaagag atggcagctg
     4201 gccgggtgca gtggctcacg tctgtaatcc cagcactttg ggaggccgag gcaggtggat
     4261 cacgaggtca ggagttcaag accagcctgg ccaagagggt gaaaccccat ctttactaaa
     4321 aatacaaaaa aaaaaattag ctgggtgtgg tggtgggctc ctgtaatccc agctactcag
     4381 gaggctaagg cagagaatca tttgaaccca ggagacggag tttgcaaagc caagatcgtg
     4441 ccactgcact ccagcctggg caacagaagg agactccgtc tcaaaaaaaa aaaaaagatg
     4501 gcagctatat aaatgataaa attaattaca ttctctttca catgcatgag gtgcaaactc
     4561 tgtcacaaag tattttaatt accttttacc ttgtttcata gatctttatg tgacataaaa
     4621 acagtttctg gcacggtggc tcacgcctgt aatcctagca ctttgggagg ctgaggcagg
     4681 tggatcacct gaggtcagga gtttgagacc agcctggcca atatggtgaa accccatctc
     4741 tacaaaattt gcaaaaagta gatgggtgtg gtagtgggcg cctgtaatcc cagctactca
     4801 ggaggttgag gcagagaatc gcttgaaccc ggggggtgga ggttgcagtg agctgagatc
     4861 gcaccactgc actccagcat gaaagagcga gactcaatct caaaaaaaaa aaagtttctg
     4921 gcacctgaac aggaactggt ttccatcatc aactcagaaa gcactaaaat ctaggtggtg
     4981 attcagggag gagcagggga agacagcctc ctatggtggc atgaataaga tgcttccaga
     5041 actagtaggg aaataactaa cctcttcagg ctttatcagg cctggagggg aaccttgctc
     5101 atgttagcaa gaaaggtatc ctagagaagc cactcaaaag gctccctaat ccagcctgtc
     5161 tccacataca tactgaaaat tcttccctac tctgaggcag ggtgtagtgg tttaggggtt
     5221 tctccagact ggaatcctac ctatctgtac cgacaattga gcaaacaaca gttgagagag
     5281 tccaaaaaaa aaagtattaa aatgtgattg atgtaattta ccatgtttac tttatgcatg
     5341 cattttattg gggaggggag gtcagaataa ttcacccaaa tctagtggtc ttatttcata
     5401 ggctaatctg gtttatattt gcattaaaga tactggaggg caatatttac agagtttagt
     5461 ttttcttaat taaaaacagt cctctattaa tatagtgtga aatatctttc aaaatttaga
     5521 gtttaggttt aagatgtcta ctagatatct ttaagatttt cctgtaaact cactgcacaa
     5581 actggaatta ctttccaaaa gacttaggga atgcaaatat gttactcata agatgcattg
     5641 agtattgtaa ataaaacaaa ccatttttga tttgtttaaa ttgctcgtta cagttctctt
     5701 gtggggaggg actttgtcag tcattttgca tcttaagcta gactaaactt tttgttgttg
     5761 ttttcctaaa accataggtg caagctttgc cgctgggaag tcatattgaa ttaagcactt
     5821 ttgaaaatgt cactgtttgt gacacacaat gttctctaca gaaaacttct tctatcttat
     5881 gtcattttag cagtagatgt agctgcctgc caccaggtgc aatatgtcat ttgcatcagc
     5941 cttttcagtt aaggaaatta aaacttggca tgcattagtt catatgtatg aggttggctg
     6001 tgtccccaaa cagcaattgc ttgtacaaga tagaagtttg cttctcagct gggcatggtg
     6061 gctcatgcct gtaatccaag ctctttggga ggccaacgcg ggaggattgt ttgagcccag
     6121 gagtttgaaa ccatcctgag caatagagag acccccatct cgacaaaaaa aaaaaaaaaa
     6181 aattagaaac aaaaaaaaga ttgtttctct ttcatattaa agtttgggaa ggcaatccag
     6241 agcccatatg acattatgca gggtcaggga tccgggttct ttctatattg ttcctcccca
     6301 ttctcaacct gtagcttttt ttttttttct tttaatgaga tagggtctca ctctgttgcc
     6361 caggctggag tgcagtggca cacttctggc tcacttcagc ctggaactcc cgggctcgag
     6421 ctatattctc ccactttagc ctcagcctcc agagtacctg ggactacagg tacacaccac
     6481 catgcctggc taaatttttt tttttttttt ttggtagaga tgaggtcatt gctatgttgc
     6541 ccaggctggc cttgaagtcc agggcttaag tgatcctcct gccttggcct cccaaagtgc
     6601 tggtgttaca ggtgtgagcc accacacctg gccaacatgt ggctttcagt tcttacttga
     6661 agacagctgc tctagctaga aacttcctat cggcatctga gccagctggt agagggcatt
     6721 acctccccca cccccaagaa cacttcttgg aagttacaca caatacataa acttcaattt
     6781 caaacagttg cttggtccca ctagccatga agctggatgg gacgtaatat tctatctggg
     6841 ttgtcatggg ccaaattaac attttgagat tctgttagga agatgagaat tggataatgg
     6901 gcacctctaa cagtgtctgt cagagttgac atacattgtg tatctcctgc accaaagcat
     6961 ttttgagatc aagtgttctt ccagctgagc agaaatttgg aaggctattc agtgctgctt
     7021 agtgtagcag ctaataatgt tccaacttct atatgatagt ttgctttttg ttttttgttt
     7081 ttttctagag acagagtctc gttgcccagg ctggtctcca attcctgggt tcaagcaatc
     7141 ctcctgactc agcctcctaa atgctgggat tacaggcatg aaccactgtg cccagtctat
     7201 atataataga ttttagaaga aatttctgcc actcagtgac tgctttaaat tctagagaca
     7261 gaggctgaga gaaacttagt agcctgcctg cgcatactgc aagtacagac tatataacaa
     7321 gttgaaagag aatcaccctg gtatataata ttttaaaaca tgaaaaaggc attactattg
     7381 ttctggtcta agtactctaa caggacgatg atttctaacc ctagcatcat gacatgtata
     7441 tagtgtgttg taagacattt gccagctaat agttacagta ctgaagcttg tgaatacgtt
     7501 aattgagaaa actttaagca ggttcaaagt tatcccatga tagtggcatt cttatttgta
     7561 tatatgtgct ttcctttttt atttgtatca aggcatttaa aatgaatata tgtaacatgt
     7621 acctaagttt taaaagcata ataaaatgaa cacatctgaa accacca
//

337

Re: Формы, механизмы, энергия наномира - 84

https://www.ncbi.nlm.nih.gov/nuccore/223555916

FT CDS 329..2077
        1 ggcccaagcc gccattgttc cgccgaggga ggacagcggg gcctggcgct ggcgccgaga
       61 cgccgcttag cggccgccac tggagacact ccctcccgcc tcccgggtct cctggcggcg
      121 gcggagtgag gctgacagcg gggaacctgg gagacccctc cgccctcccc gcggtggcag
      181 cggccgatcc ccggctccgg cgcgagggac ggccgcgatg cgctcggcct gaggttaccc
      241 ggcccggccc ttcctcgctt ccctcgacta ttccactgcg tctccgcgcc ccggcgtcat
      301 cctgcgagtc cctctgacgg gagggaagat ggctgcacgg agctggcagg acgagctggc
      361 ccagcaggcc gaggagggct cggcccggct gcgggaaatg ctctcggtcg gcctaggctt
      421 tctgcgcacc gagctgggcc tcgacctggg gctggagccg aaacggtacc ccggctgggt
      481 gatcctggtg ggcactggcg cgctcgggct gctgctgctg tttctgctgg gctacggctg
      541 ggccgcggct tgcgccggcg cccgcaaaaa gcggaggagc ccgccccgca agcgggagga
      601 ggcggcggcc gtgccggccg cggcccccga cgacctggcc ttgctgaaga atctccggag
      661 cgaggaacag aagaagaaga accggaagaa actgtccgag aagcccaaac caaatgggcg
      721 gactgttgaa gtggctgagg gtgaagctgt tcgaacacct caaagtgtaa cagcaaagca
      781 gccaccagag attgacaaga aaaatgaaaa gtcaaagaaa aataagaaga aatcaaagtc
      841 agatgctaaa gcagtgcaaa acagttcacg ccatgatgga aaggaagttg atgaaggagc
      901 ctgggaaact aaaattagtc acagagagaa acgacagcag cgtaaacgtg ataaggtgct
      961 gactgattct ggttcattgg attcaactat ccctgggata gaaaatacca tcacagttac
     1021 caccgagcaa cttacaaccg catcatttcc tgttggttcc aagaagaata aaggtgattc
     1081 tcatctaaat gttcaagtta gcaactttaa atctggaaaa ggagattcta cacttcaggt
     1141 ttcttcagga ttgaatgaaa acctcactgt caatggagga ggctggaatg aaaagtctgt
     1201 aaaactctcc tcacagatca gtgcaggtga ggagaagtgg aactccgttt cacctgcttc
     1261 tgcaggaaag aggaaaactg agccatctgc ctggagtcaa gacactggag atgctaatac
     1321 aaatggaaaa gactggggaa ggagttggag tgaccgttca atattttctg gcattgggtc
     1381 tactgctgag ccagtttctc agtctaccac ttctgattat cagtgggatg ttagccgtaa
     1441 tcaaccctat atcgatgatg aatggtctgg gttaaatggt ctgtcttctg ctgatcccaa
     1501 ctctgattgg aatgcaccag cagaagagtg gggcaattgg gtagacgaag aaagagcttc
     1561 acttctaaag tcccaggaac caattcctga tgatcaaaag gtctcagatg atgataaaga
     1621 aaagggagag ggagctcttc caactgggaa atccaaaaag aaaaaaaaga aaaagaagaa
     1681 gcaaggtgaa gataactcta ctgcacagga cacagaagaa ttagaaaaag agattagaga
     1741 agaccttcca gtgaatacct ctaaaacccg tccaaaacag gaaaaagctt tttccttgaa
     1801 gaccataagc actagtgatc cagccgaagt actcgtcaaa aatagccagc ctatcaagac
     1861 tcttccacct gctacttcta ccgagccatc tgtaatctta tcaaaaagtg attctgacaa
     1921 gagctcttcc caagtgccgc caatactaca agagacagat aaatccaagt caaataccaa
     1981 gcaaaatagt gtgcctcctt cacagaccaa gtctgaaact agctgggaat ctcccaaaca
     2041 aataaaaaag aagaaaaaag ccagacgaga aacgtgaaat tttttttcct gaattggaca
     2101 tgtgtttgca aacacttgtc ttgaagatta tgctgtttat gcaataattt gtgaacatgt
     2161 acagagtttt atataaattt aaaccaattt ttaaaacaaa actgcggaca ccaccataaa
     2221 aatggaatca aaagaaagtt aatttatgaa attaagaggt cagcagaata tactcagtga
     2281 tggaagacac ttgggaaagt ctttttaata gaacaagaac gatcttaatt taagaatatt
     2341 atcctggttt aacaacagtg ccctgtttac aacagattgt gccctatctc atctgcagcc
     2401 gaggaataaa ggattctgat tagaaagagg gttgcctaca gattagtaag caattccttg
     2461 gatcttatgc acagaacttg taccatttga atctgtttta tgcttaaatc aaagtgcttt
     2521 gatcaaatgc ataacctgcc atatctttac atatttgttg gtagcaattt gtattaaaga
     2581 aatcacaagt gcaaataaaa agtcatttat catttgttta actaaactgt catggtttag
     2641 tttacaattt ttaaaaagtt cttaaaatac tgaaaatgca gttgacactt gtgtatggct
     2701 tatgaagtta tttttgatag tcttacatta cttgaattgt tcaaagtaca gtatatttta
     2761 aattaagaaa agtgaactat atgtatttgt tttatacatt taaggcttag actcataaat
     2821 aatgctattg tttatgattt gaaaactttc aggcaaaatc caatttacat ttttcccttc
     2881 cctagcaatt acttttttcc agcttcaact cttcttagtt actaatactt tgttgacttt
     2941 aaaaatgaaa tcattcacaa acttttggta tatgatggag aatgaaaaac tagagtcaga
     3001 cagctttaat tgacattgtc aacacctcca gttatcagga atacattttt ttactgcctt
     3061 aacctgtagt gcgtagaata tgcatcaatt tcttgaagga gattcatgtt tttataagaa
     3121 ttttcatgta attattgcaa ttgtggtcaa ataaggaacg tttcctgctt gaaattatat
     3181 tgatttaaat gatgtgtgag atgtttcacc attttcaggc actgtgtaat tctattgtaa
     3241 taaactggca ggtatctttg taactataaa tagtgcatgc tcagccatgt acactgtaaa
     3301 tagcctttac caaacgtgtt tgacaaggac cataattaac atcacttagt gaattgtgat
     3361 aaagaaaaaa aagccatgat ttattcgatg tgattggctt gtttttatgt ggcgccaaga
     3421 acgaacctgt ttaacagctg taaccaatgg tactgatcta tccatccaat gttgtcatta
     3481 tatttgactg tggttcaaca gtattgcgtt gtcagactag gaaagctaaa cgaacaaaat
     3541 ggttttagtt ttgctgaaga ctggccttat taatggacag ctttcctaac aagagattat
     3601 taacttttat caggtgttaa catctgtttc aggaacatgg cagtatgttt acatgtcaga
     3661 agttttgttt aattctatgg tatttctaaa ttgacttgtt taaataaatt cagcaaatgg
     3721 atagcattgt tttttatttg cttcaatatg ggggtagata atagctaaag agccaaggat
     3781 gaatttcttc aaatgacttt attctgttag ctttacatag gtgttggagg attcctaagg
     3841 tgtcagcatt ttgtaaaggt accacaaagg agaagttgat agggaatcta attttagaat
     3901 gtgccaaatg gtctgtgctc aacaatataa ttgaactctc tcaactctac ctcaccattt
     3961 ctttatctca aaattctgtt ggctttgtca aacgttggat tttatttctg cagcctagta
     4021 tctccccatt ctaccaccta tgccagatgt taaagacagc agatgttttg aggagaatgg
     4081 cattgtggag atgcagagat gcgttgctaa gttgaggtgg atccagtata gagatacctc
     4141 tatttcttct ttatggctca agagctagga cttggatttt gttttaagag atggcagctg
     4201 gccgggtgca gtggctcacg tctgtaatcc cagcactttg ggaggccgag gcaggtggat
     4261 cacgaggtca ggagttcaag accagcctgg ccaagagggt gaaaccccat ctttactaaa
     4321 aatacaaaaa aaaaaattag ctgggtgtgg tggtgggctc ctgtaatccc agctactcag
     4381 gaggctaagg cagagaatca tttgaaccca ggagacggag tttgcaaagc caagatcgtg
     4441 ccactgcact ccagcctggg caacagaagg agactccgtc tcaaaaaaaa aaaaaagatg
     4501 gcagctatat aaatgataaa attaattaca ttctctttca catgcatgag gtgcaaactc
     4561 tgtcacaaag tattttaatt accttttacc ttgtttcata gatctttatg tgacataaaa
     4621 acagtttctg gcacggtggc tcacgcctgt aatcctagca ctttgggagg ctgaggcagg
     4681 tggatcacct gaggtcagga gtttgagacc agcctggcca atatggtgaa accccatctc
     4741 tacaaaattt gcaaaaagta gatgggtgtg gtagtgggcg cctgtaatcc cagctactca
     4801 ggaggttgag gcagagaatc gcttgaaccc ggggggtgga ggttgcagtg agctgagatc
     4861 gcaccactgc actccagcat gaaagagcga gactcaatct caaaaaaaaa aaagtttctg
     4921 gcacctgaac aggaactggt ttccatcatc aactcagaaa gcactaaaat ctaggtggtg
     4981 attcagggag gagcagggga agacagcctc ctatggtggc atgaataaga tgcttccaga
     5041 actagtaggg aaataactaa cctcttcagg ctttatcagg cctggagggg aaccttgctc
     5101 atgttagcaa gaaaggtatc ctagagaagc cactcaaaag gctccctaat ccagcctgtc
     5161 tccacataca tactgaaaat tcttccctac tctgaggcag ggtgtagtgg tttaggggtt
     5221 tctccagact ggaatcctac ctatctgtac cgacaattga gcaaacaaca gttgagagag
     5281 tccaaaaaaa aaagtattaa aatgtgattg atgtaattta ccatgtttac tttatgcatg
     5341 cattttattg gggaggggag gtcagaataa ttcacccaaa tctagtggtc ttatttcata
     5401 ggctaatctg gtttatattt gcattaaaga tactggaggg caatatttac agagtttagt
     5461 ttttcttaat taaaaacagt cctctattaa tatagtgtga aatatctttc aaaatttaga
     5521 gtttaggttt aagatgtcta ctagatatct ttaagatttt cctgtaaact cactgcacaa
     5581 actggaatta ctttccaaaa gacttaggga atgcaaatat gttactcata agatgcattg
     5641 agtattgtaa ataaaacaaa ccatttttga tttgtttaaa ttgctcgtta cagttctctt
     5701 gtggggaggg actttgtcag tcattttgca tcttaagcta gactaaactt tttgttgttg
     5761 ttttcctaaa accataggtg caagctttgc cgctgggaag tcatattgaa ttaagcactt
     5821 ttgaaaatgt cactgtttgt gacacacaat gttctctaca gaaaacttct tctatcttat
     5881 gtcattttag cagtagatgt agctgcctgc caccaggtgc aatatgtcat ttgcatcagc
     5941 cttttcagtt aaggaaatta aaacttggca tgcattagtt catatgtatg aggttggctg
     6001 tgtccccaaa cagcaattgc ttgtacaaga tagaagtttg cttctcagct gggcatggtg
     6061 gctcatgcct gtaatccaag ctctttggga ggccaacgcg ggaggattgt ttgagcccag
     6121 gagtttgaaa ccatcctgag caatagagag acccccatct cgacaaaaaa aaaaaaaaaa
     6181 aattagaaac aaaaaaaaga ttgtttctct ttcatattaa agtttgggaa ggcaatccag
     6241 agcccatatg acattatgca gggtcaggga tccgggttct ttctatattg ttcctcccca
     6301 ttctcaacct gtagcttttt ttttttttct tttaatgaga tagggtctca ctctgttgcc
     6361 caggctggag tgcagtggca cacttctggc tcacttcagc ctggaactcc cgggctcgag
     6421 ctatattctc ccactttagc ctcagcctcc agagtacctg ggactacagg tacacaccac
     6481 catgcctggc taaatttttt tttttttttt ttggtagaga tgaggtcatt gctatgttgc
     6541 ccaggctggc cttgaagtcc agggcttaag tgatcctcct gccttggcct cccaaagtgc
     6601 tggtgttaca ggtgtgagcc accacacctg gccaacatgt ggctttcagt tcttacttga
     6661 agacagctgc tctagctaga aacttcctat cggcatctga gccagctggt agagggcatt
     6721 acctccccca cccccaagaa cacttcttgg aagttacaca caatacataa acttcaattt
     6781 caaacagttg cttggtccca ctagccatga agctggatgg gacgtaatat tctatctggg
     6841 ttgtcatggg ccaaattaac attttgagat tctgttagga agatgagaat tggataatgg
     6901 gcacctctaa cagtgtctgt cagagttgac atacattgtg tatctcctgc accaaagcat
     6961 ttttgagatc aagtgttctt ccagctgagc agaaatttgg aaggctattc agtgctgctt
     7021 agtgtagcag ctaataatgt tccaacttct atatgatagt ttgctttttg ttttttgttt
     7081 ttttctagag acagagtctc gttgcccagg ctggtctcca attcctgggt tcaagcaatc
     7141 ctcctgactc agcctcctaa atgctgggat tacaggcatg aaccactgtg cccagtctat
     7201 atataataga ttttagaaga aatttctgcc actcagtgac tgctttaaat tctagagaca
     7261 gaggctgaga gaaacttagt agcctgcctg cgcatactgc aagtacagac tatataacaa
     7321 gttgaaagag aatcaccctg gtatataata ttttaaaaca tgaaaaaggc attactattg
     7381 ttctggtcta agtactctaa caggacgatg atttctaacc ctagcatcat gacatgtata
     7441 tagtgtgttg taagacattt gccagctaat agttacagta ctgaagcttg tgaatacgtt
     7501 aattgagaaa actttaagca ggttcaaagt tatcccatga tagtggcatt cttatttgta
     7561 tatatgtgct ttcctttttt atttgtatca aggcatttaa aatgaatata tgtaacatgt
     7621 acctaagttt taaaagcata ataaaatgaa cacatctgaa accacca
//

Композиционный код:

1,3,2,4,1,1,1,1,1,4,1,1,1,1,1,1,1,4,1,4,4,4,3,1,1,4,1,1,2,1,3,4,1,1,1,4,1,1,1,4,4,4,1,4,3,4,1,1,1,1,4,1,4,4,1,3,1,
4,1,4,4,4,4,4,3,4,4,1,1,1,1,1,4,3,1,1,1,1,1,3,1,4,1,1,4,1,1,1,4,1,1,4,4,1,4,4,1,4,1,1,1,1,4,1,1,4,1,3,1,4,1,1,3,1,
1,1,1,1,4,1,3,4,1,1,1,1,3,2,3,4,4,3,3,3,4,3,1,3,3,3,3,2,2,3,3,3,2,2,2,1,1,2,2,1,3,1,1,3,3,3,1,2,1,3,3,1,1,3,2,1,2,
3,3,3,2,4,3,1,3,2,1,3,3,2,1,3,3,3,3,2,1,1,3,3,3,3,3,1,3,1,3,2,1,1,3,3,3,3,1,4,4,3,3,3,3,2,1,3,2,3,1,3,4,2,3,3,1,1,
2,3,1,1,1,3,3,2,1,2,2,3,3,3,3,1,1,1,3,3,3,3,3,3,2,3,3,3,3,1,1,3,3,3,2,3,2,3,3,2,3,1,3,3,2,2,1,3,3,1,1,3,1,3,2,2,1,
1,3,3,1,3,2,3,1,1,2,1,1,3,2,3,1,1,1,1,1,1,3,2,3,3,3,2,2,1,1,3,3,1,2,3,1,1,3,3,1,3,2,3,3,3,2,3,2,3,1,1,2,1,3,1,3,1,
3,2,2,3,3,1,3,4,3,3,3,1,2,3,3,1,3,1,3,3,3,3,1,1,3,3,1,3,3,3,1,3,1,3,3,3,1,3,4,3,3,3,4,3,3,3,3,1,1,3,3,1,3,2,2,2,3,
1,1,1,3,1,2,1,3,3,3,3,2,3,2,1,1,1,3,2,3,3,3,3,3,1,1,2,3,3,3,3,3,1,2,1,2,3,3,2,3,4,3,1,3,1,3,3,1,3,1,1,1,3,3,3,3,1,
3,3,2,1,1,2,3,3,3,3,3,1,3,3,3,1,3,2,4,3,1,3,3,1,3,2,3,1,3,3,3,3,1,1,1,1,2,1,3,3,3,2,1,3,2,1,1,3,3,1,1,3,1,1,3,3,2,
3,3,3,3,1,1,2,3,2,1,3,2,3,3,3,3,1,1,1,3,1,3,4,4,2,2,2,3,1,2,3,3,1,1,2,3,1,1,3,3,3,4,3,3,2,1,1,1,3,3,3,1,1,3,3,1,3,
3,2,3,1,1,3,3,1,3,2,3,4

Вторичная структура (Пикотех):

https://img-fotki.yandex.ru/get/196161/ … 2_orig.gif

https://img-fotki.yandex.ru/get/149948/158289418.3be/0_170134_9e60981c_orig.png

https://img-fotki.yandex.ru/get/94596/158289418.3be/0_170135_10be37e_orig.png

https://img-fotki.yandex.ru/get/198998/158289418.3be/0_170136_a017563a_orig.png
Кушелев: Ну вот, уже что-то похожее на лизиновый "хвостик" smile

338

Re: Формы, механизмы, энергия наномира - 84

https://www.ncbi.nlm.nih.gov/protein/15 … C0A790J015

transmembrane inner ear expressed protein precursor [Homo sapiens]
NCBI Reference Sequence: NP_671729.2
Identical Proteins FASTA Graphics
Go to:
LOCUS       NP_671729                156 aa            linear   PRI 07-OCT-2016
DEFINITION  transmembrane inner ear expressed protein precursor [Homo sapiens].
ACCESSION   NP_671729
VERSION     NP_671729.2
DBSOURCE    REFSEQ: accession NM_147196.2
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (residues 1 to 156)
  AUTHORS   Ganapathy A, Pandey N, Srisailapathy CR, Jalvi R, Malhotra V,
            Venkatappa M, Chatterjee A, Sharma M, Santhanam R, Chadha S, Ramesh
            A, Agarwal AK, Rangasayee RR and Anand A.
  TITLE     Non-syndromic hearing impairment in India: high allelic
            heterogeneity among mutations in TMPRSS3, TMC1, USHIC, CDH23 and
            TMIE
  JOURNAL   PLoS ONE 9 (1), E84773 (2014)
   PUBMED   24416283
  REMARK    GeneRIF: Description of the spectrum of mutations in TMIE in 374
            families with autosomal recessive, non-syndromic hearing loss from
            India.
            Publication Status: Online-Only
REFERENCE   2  (residues 1 to 156)
  AUTHORS   Yang JJ, Su MC, Chien KH, Hsin CH and Li SY.
  TITLE     Identification of novel variants in the TMIE gene of patients with
            nonsyndromic hearing loss
  JOURNAL   Int. J. Pediatr. Otorhinolaryngol. 74 (5), 489-493 (2010)
   PUBMED   20206386
  REMARK    GeneRIF: We suggest that a missense variant and one promoter
            variant is de novo and may be a risk factor for the development of
            hearing loss in Taiwanese
            GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   3  (residues 1 to 156)
  AUTHORS   Sirmaci A, Ozturkmen-Akay H, Erbek S, Incesulu A, Duman D,
            Tasir-Yilmaz S, Ozdag H and Tekin M.
  TITLE     A founder TMIE mutation is a frequent cause of hearing loss in
            southeastern Anatolia
  JOURNAL   Clin. Genet. 75 (6), 562-567 (2009)
   PUBMED   19438934
  REMARK    GeneRIF: p.R84W could be a common mutation in other Middle Eastern
            populations and should be included in mutation screening offered to
            individuals with autosomal recessive non-syndromic sensorineural
            hearing loss (ARNSSNHL)
REFERENCE   4  (residues 1 to 156)
  AUTHORS   Santos RL, El-Shanti H, Sikandar S, Lee K, Bhatti A, Yan K,
            Chahrour MH, McArthur N, Pham TL, Mahasneh AA, Ahmad W and Leal SM.
  TITLE     Novel sequence variants in the TMIE gene in families with autosomal
            recessive nonsyndromic hearing impairment
  JOURNAL   J. Mol. Med. 84 (3), 226-231 (2006)
   PUBMED   16389551
REFERENCE   5  (residues 1 to 156)
  AUTHORS   Cho KI, Lee JW, Kim KS, Lee EJ, Suh JG, Lee HJ, Kim HT, Hong SH,
            Chung WH, Chang KT, Hyun BH, Oh YS and Ryoo ZY.
  TITLE     Fine mapping of the circling (cir) gene on the distal portion of
            mouse chromosome 9
  JOURNAL   Comp. Med. 53 (6), 642-648 (2003)
   PUBMED   14727813
  REMARK    GeneRIF: The circling mouse is a potential animal model for DFNB6
            deafness in humans.
REFERENCE   6  (residues 1 to 156)
  AUTHORS   Mitchem KL, Hibbard E, Beyer LA, Bosom K, Dootz GA, Dolan DF,
            Johnson KR, Raphael Y and Kohrman DC.
  TITLE     Mutation of the novel gene Tmie results in sensory cell defects in
            the inner ear of spinner, a mouse model of human hearing loss DFNB6
  JOURNAL   Hum. Mol. Genet. 11 (16), 1887-1898 (2002)
   PUBMED   12140191
  REMARK    GeneRIF: genetic mapping data support human TMIE as the gene
            affected at DFNB6, a non-syndromic hearing loss locus
REFERENCE   7  (residues 1 to 156)
  AUTHORS   Petit C.
  TITLE     Genes responsible for human hereditary deafness: symphony of a
            thousand
  JOURNAL   Nat. Genet. 14 (4), 385-391 (1996)
   PUBMED   8944017
  REMARK    Review article
REFERENCE   8  (residues 1 to 156)
  AUTHORS   Lanfranchi,G., Muraro,T., Caldara,F., Pacchioni,B., Pallavicini,A.,
            Pandolfo,D., Toppo,S., Trevisan,S., Scarso,S. and Valle,G.
  TITLE     Identification of 4370 expressed sequence tags from a
            3'-end-specific cDNA library of human skeletal muscle by DNA
            sequencing and filter hybridization
  JOURNAL   Genome Res. 6 (1), 35-42 (1996)
   PUBMED   8681137
REFERENCE   9  (residues 1 to 156)
  AUTHORS   Fukushima K, Ramesh A, Srisailapathy CR, Ni L, Wayne S, O'Neill ME,
            Van Camp G, Coucke P, Jain P, Wilcox ER, Smith SD, Kenyon JB, Zbar
            RI and Smith RJ.
  TITLE     An autosomal recessive nonsyndromic form of sensorineural hearing
            loss maps to 3p-DFNB6
  JOURNAL   Genome Res. 5 (3), 305-308 (1995)
   PUBMED   8593615
REFERENCE   10 (residues 1 to 156)
  AUTHORS   Smith,R.J.H., Shearer,A.E., Hildebrand,M.S. and Van Camp,G.
  TITLE     Deafness and Hereditary Hearing Loss Overview
  JOURNAL   (in) Pagon RA, Adam MP, Ardinger HH, Wallace SE, Amemiya A, Bean
            LJH, Bird TD, Fong CT, Mefford HC, Smith RJH and Stephens K (Eds.);
            GENEREVIEWS(R);
            (1993)
   PUBMED   20301607
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AY081842.1 and AC134504.2.
            This sequence is a reference standard in the RefSeqGene project.
            On Oct 24, 2007 this sequence version replaced gi:22218347.
           
            Summary: This gene encodes a transmembrane inner ear protein.
            Studies in mouse suggest that this gene is required for normal
            postnatal maturation of sensory hair cells in the cochlea,
            including correct development of stereocilia bundles. This gene is
            one of multiple genes responsible for recessive non-syndromic
            deafness (DFNB), also known as autosomal recessive nonsyndromic
            hearing loss (ARNSHL), the most common form of congenitally
            acquired inherited hearing impairment. [provided by RefSeq, Mar
            2009].
           
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
           
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
           
            ##Evidence-Data-START##
            Transcript exon combination :: AY081842.1, BC126258.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA1965299, SAMEA1968540
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..156
                     /organism="Homo sapiens"
                     /db_xref="taxon:9606"
                     /chromosome="3"
                     /map="3p21.31"
     Protein         1..156
                     /product="transmembrane inner ear expressed protein
                     precursor"
                     /note="transmembrane inner ear protein; transmembrane
                     inner ear expressed protein"
     sig_peptide     1..27
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
                     /calculated_mol_wt=2369
     mat_peptide     28..156
                     /product="transmembrane inner ear expressed protein"
                     /calculated_mol_wt=14891
     Region          46..122
                     /region_name="TMIE"
                     /note="TMIE protein; pfam16038"
                     /db_xref="CDD:292657"
     Site            58..78
                     /site_type="transmembrane region"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q8NEW7.2)"
     CDS             1..156
                     /gene="TMIE"
                     /gene_synonym="DFNB6"
                     /coded_by="NM_147196.2:156..626"
                     /db_xref="CCDS:CCDS43081.1"
                     /db_xref="GeneID:259236"
                     /db_xref="HGNC:HGNC:30800"
                     /db_xref="MIM:607237"
ORIGIN     
        1 magwpgagpl cvlggaalgv clagvagqlv epstappkpk pppltketvv fwdmrlwhvv
       61 gifslfvlsi iitlccvfnc rvprtrkeie arylqrkaak mytdkletvp plneltevpg
      121 edkkkkkkkk kdsvdtvaik veedekneak kkkgek
//

339

Re: Формы, механизмы, энергия наномира - 84

https://www.ncbi.nlm.nih.gov/nuccore/158631210

Homo sapiens transmembrane inner ear (TMIE), mRNA
NCBI Reference Sequence: NM_147196.2
FASTA Graphics
Go to:
LOCUS       NM_147196               1861 bp    mRNA    linear   PRI 07-OCT-2016
DEFINITION  Homo sapiens transmembrane inner ear (TMIE), mRNA.
ACCESSION   NM_147196
VERSION     NM_147196.2
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1861)
  AUTHORS   Ganapathy A, Pandey N, Srisailapathy CR, Jalvi R, Malhotra V,
            Venkatappa M, Chatterjee A, Sharma M, Santhanam R, Chadha S, Ramesh
            A, Agarwal AK, Rangasayee RR and Anand A.
  TITLE     Non-syndromic hearing impairment in India: high allelic
            heterogeneity among mutations in TMPRSS3, TMC1, USHIC, CDH23 and
            TMIE
  JOURNAL   PLoS ONE 9 (1), E84773 (2014)
   PUBMED   24416283
  REMARK    GeneRIF: Description of the spectrum of mutations in TMIE in 374
            families with autosomal recessive, non-syndromic hearing loss from
            India.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1861)
  AUTHORS   Yang JJ, Su MC, Chien KH, Hsin CH and Li SY.
  TITLE     Identification of novel variants in the TMIE gene of patients with
            nonsyndromic hearing loss
  JOURNAL   Int. J. Pediatr. Otorhinolaryngol. 74 (5), 489-493 (2010)
   PUBMED   20206386
  REMARK    GeneRIF: We suggest that a missense variant and one promoter
            variant is de novo and may be a risk factor for the development of
            hearing loss in Taiwanese
            GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   3  (bases 1 to 1861)
  AUTHORS   Sirmaci A, Ozturkmen-Akay H, Erbek S, Incesulu A, Duman D,
            Tasir-Yilmaz S, Ozdag H and Tekin M.
  TITLE     A founder TMIE mutation is a frequent cause of hearing loss in
            southeastern Anatolia
  JOURNAL   Clin. Genet. 75 (6), 562-567 (2009)
   PUBMED   19438934
  REMARK    GeneRIF: p.R84W could be a common mutation in other Middle Eastern
            populations and should be included in mutation screening offered to
            individuals with autosomal recessive non-syndromic sensorineural
            hearing loss (ARNSSNHL)
REFERENCE   4  (bases 1 to 1861)
  AUTHORS   Santos RL, El-Shanti H, Sikandar S, Lee K, Bhatti A, Yan K,
            Chahrour MH, McArthur N, Pham TL, Mahasneh AA, Ahmad W and Leal SM.
  TITLE     Novel sequence variants in the TMIE gene in families with autosomal
            recessive nonsyndromic hearing impairment
  JOURNAL   J. Mol. Med. 84 (3), 226-231 (2006)
   PUBMED   16389551
REFERENCE   5  (bases 1 to 1861)
  AUTHORS   Cho KI, Lee JW, Kim KS, Lee EJ, Suh JG, Lee HJ, Kim HT, Hong SH,
            Chung WH, Chang KT, Hyun BH, Oh YS and Ryoo ZY.
  TITLE     Fine mapping of the circling (cir) gene on the distal portion of
            mouse chromosome 9
  JOURNAL   Comp. Med. 53 (6), 642-648 (2003)
   PUBMED   14727813
  REMARK    GeneRIF: The circling mouse is a potential animal model for DFNB6
            deafness in humans.
REFERENCE   6  (bases 1 to 1861)
  AUTHORS   Mitchem KL, Hibbard E, Beyer LA, Bosom K, Dootz GA, Dolan DF,
            Johnson KR, Raphael Y and Kohrman DC.
  TITLE     Mutation of the novel gene Tmie results in sensory cell defects in
            the inner ear of spinner, a mouse model of human hearing loss DFNB6
  JOURNAL   Hum. Mol. Genet. 11 (16), 1887-1898 (2002)
   PUBMED   12140191
  REMARK    GeneRIF: genetic mapping data support human TMIE as the gene
            affected at DFNB6, a non-syndromic hearing loss locus
REFERENCE   7  (bases 1 to 1861)
  AUTHORS   Petit C.
  TITLE     Genes responsible for human hereditary deafness: symphony of a
            thousand
  JOURNAL   Nat. Genet. 14 (4), 385-391 (1996)
   PUBMED   8944017
  REMARK    Review article
REFERENCE   8  (bases 1 to 1861)
  AUTHORS   Lanfranchi,G., Muraro,T., Caldara,F., Pacchioni,B., Pallavicini,A.,
            Pandolfo,D., Toppo,S., Trevisan,S., Scarso,S. and Valle,G.
  TITLE     Identification of 4370 expressed sequence tags from a
            3'-end-specific cDNA library of human skeletal muscle by DNA
            sequencing and filter hybridization
  JOURNAL   Genome Res. 6 (1), 35-42 (1996)
   PUBMED   8681137
REFERENCE   9  (bases 1 to 1861)
  AUTHORS   Fukushima K, Ramesh A, Srisailapathy CR, Ni L, Wayne S, O'Neill ME,
            Van Camp G, Coucke P, Jain P, Wilcox ER, Smith SD, Kenyon JB, Zbar
            RI and Smith RJ.
  TITLE     An autosomal recessive nonsyndromic form of sensorineural hearing
            loss maps to 3p-DFNB6
  JOURNAL   Genome Res. 5 (3), 305-308 (1995)
   PUBMED   8593615
REFERENCE   10 (bases 1 to 1861)
  AUTHORS   Smith,R.J.H., Shearer,A.E., Hildebrand,M.S. and Van Camp,G.
  TITLE     Deafness and Hereditary Hearing Loss Overview
  JOURNAL   (in) Pagon RA, Adam MP, Ardinger HH, Wallace SE, Amemiya A, Bean
            LJH, Bird TD, Fong CT, Mefford HC, Smith RJH and Stephens K (Eds.);
            GENEREVIEWS(R);
            (1993)
   PUBMED   20301607
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AY081842.1 and AC134504.2.
            This sequence is a reference standard in the RefSeqGene project.
            On Oct 24, 2007 this sequence version replaced gi:22218346.
           
            Summary: This gene encodes a transmembrane inner ear protein.
            Studies in mouse suggest that this gene is required for normal
            postnatal maturation of sensory hair cells in the cochlea,
            including correct development of stereocilia bundles. This gene is
            one of multiple genes responsible for recessive non-syndromic
            deafness (DFNB), also known as autosomal recessive nonsyndromic
            hearing loss (ARNSHL), the most common form of congenitally
            acquired inherited hearing impairment. [provided by RefSeq, Mar
            2009].
           
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
           
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
           
            ##Evidence-Data-START##
            Transcript exon combination :: AY081842.1, BC126258.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA1965299, SAMEA1968540
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-542               AY081842.1         1-542
            543-1861            AC134504.2         44831-46149         c
FEATURES             Location/Qualifiers
     source          1..1861
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="3"
                     /map="3p21.31"
     gene            1..1861
                     /gene="TMIE"
                     /gene_synonym="DFNB6"
                     /note="transmembrane inner ear"
                     /db_xref="GeneID:259236"
                     /db_xref="HGNC:HGNC:30800"
                     /db_xref="MIM:607237"
     exon            1..248
                     /gene="TMIE"
                     /gene_synonym="DFNB6"
                     /inference="alignment:Splign:1.39.8"
     STS             38..1027
                     /gene="TMIE"
                     /gene_synonym="DFNB6"
                     /db_xref="UniSTS:486072"
     STS             56..799
                     /gene="TMIE"
                     /gene_synonym="DFNB6"
                     /db_xref="UniSTS:481311"
     STS             85..713
                     /gene="TMIE"
                     /gene_synonym="DFNB6"
                     /db_xref="UniSTS:482560"
     misc_feature    99..101
                     /gene="TMIE"
                     /gene_synonym="DFNB6"
                     /note="upstream in-frame stop codon"
     CDS             156..626
                     /gene="TMIE"
                     /gene_synonym="DFNB6"
                     /note="transmembrane inner ear protein; transmembrane
                     inner ear expressed protein"
                     /codon_start=1
                     /product="transmembrane inner ear expressed protein
                     precursor"
                     /protein_id="NP_671729.2"
                     /db_xref="CCDS:CCDS43081.1"
                     /db_xref="GeneID:259236"
                     /db_xref="HGNC:HGNC:30800"
                     /db_xref="MIM:607237"
                     /translation="MAGWPGAGPLCVLGGAALGVCLAGVAGQLVEPSTAPPKPKPPPL
                     TKETVVFWDMRLWHVVGIFSLFVLSIIITLCCVFNCRVPRTRKEIEARYLQRKAAKMY
                     TDKLETVPPLNELTEVPGEDKKKKKKKKKDSVDTVAIKVEEDEKNEAKKKKGEK"
     sig_peptide     156..236
                     /gene="TMIE"
                     /gene_synonym="DFNB6"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     mat_peptide     237..623
                     /gene="TMIE"
                     /gene_synonym="DFNB6"
                     /product="transmembrane inner ear expressed protein"
     misc_feature    327..389
                     /gene="TMIE"
                     /gene_synonym="DFNB6"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q8NEW7.2);
                     transmembrane region"
     exon            249..366
                     /gene="TMIE"
                     /gene_synonym="DFNB6"
                     /inference="alignment:Splign:1.39.8"
     exon            367..516
                     /gene="TMIE"
                     /gene_synonym="DFNB6"
                     /inference="alignment:Splign:1.39.8"
     exon            517..1861
                     /gene="TMIE"
                     /gene_synonym="DFNB6"
                     /inference="alignment:Splign:1.39.8"
     STS             1179..1840
                     /gene="TMIE"
                     /gene_synonym="DFNB6"
                     /standard_name="TMIE__5098"
                     /db_xref="UniSTS:466512"
     regulatory      1801..1806
                     /regulatory_class="polyA_signal_sequence"
                     /gene="TMIE"
                     /gene_synonym="DFNB6"
     polyA_site      1824
                     /gene="TMIE"
                     /gene_synonym="DFNB6"
ORIGIN     
        1 ggcggcgcgg gaacctgaca ccgaggatga ataaatgatg ctcgctgact acccgtggcc
       61 aaagcccgtg gccaccgagc gccggctggc aggggcagtg accggcggcc ggcccgttcg
      121 tccctgggct ccgcaagcgg cgcggtggca cgaagatggc ggggtggccg ggcgcgggtc
      181 ccctctgcgt gctgggcggc gccgcactcg gggtgtgcct cgcgggggtt gccgggcagc
      241 tggtggagcc cagcacggcc ccacccaagc ccaagccgcc tccgctgacc aaggagacag
      301 tggtgttctg ggacatgcgc ctgtggcacg tggtgggcat cttttcgctc ttcgtgttgt
      361 ccatcatcat cacgctgtgc tgtgtcttca actgtcgtgt gccacggacc cggaaggaga
      421 tcgaagcccg gtacctgcag cgaaaggcag ccaagatgta cacagacaag ctggagactg
      481 tgccacccct caatgagctc acagaagtcc caggagagga taagaagaag aagaagaaga
      541 agaagaagga cagtgtggac acagtggcca tcaaagtaga ggaggatgag aagaatgagg
      601 ccaagaagaa gaaaggagag aaatgaagac atcctgggca gcttgggctg gcgggccctg
      661 gagctcaagc cgtggccggg gtccaggcat gttggactct gagctcattt ggggaccaca
      721 gaggctgtgg tcagagaggg aagctgaggc ccatggccac atcctcatgg cccatcaggg
      781 gcaggaacca gacaatctcg taggtgtcct gccccccagc ctaggcttgg ctcctttcac
      841 cccatccaca tgggtactgt ctcggcagag gtggtctggt gccaccgtcc ctctgcagat
      901 acactgctct ccccacccag acctgcctgt ctcccaccct ttctgccagg gatggcagtg
      961 gctgtgaagg agtaatggga tatggggtta cttcagccac cctttctggc acgaaatggc
     1021 tgaagtgcat gggtcagggt gtgaggccac acccagagta gccatgagga ggcagagagg
     1081 gtcactgggg gacactgtgg cagcaggagg gactctgtct ggccagggag gagccccagt
     1141 ggtgagaaga cttccccaag cctggcaggg gatccagctc aagggagtaa gtagaggtgg
     1201 cttcagaaat ggaaccccca gcccagcaga catcaagctc aaggcaatgg gctaccctca
     1261 tttcacacgt tgtgatgaag ctgaggctgc tgccaggccc ggcatgaggc cccgaggctc
     1321 gagctcgggg ctgggggctg cagggctggg tcaggggtac acagagctaa ggccaatggg
     1381 ctagagggtg ccggaaagag agctggagtc tgggctcctc ttgggaatca gagtatattt
     1441 aagaagccaa gggggacctc gggctgttct ggtggcccct tctatgccca gctgtgctgg
     1501 gaggtcccag ggccctagaa gatcacagca gggccttctg cctgctgacc ataacagtgc
     1561 cagcttcttt gcagcttcct cttctaccat ttcccactac gggcacctaa aagaagcatc
     1621 tctgaccaga agacaaaggc ccaaatagca cctgggggag ggaagatgca cagaggcact
     1681 tccagatggc atcgaacaga ctaaggctct gaaacctagg cctgaacact aaggtctcga
     1741 gacaccagag gtttctgagc caggagagcc tgctggaaaa gcagcctgca gagatttgtg
     1801 aataaagctg attgccttct cagagccagg cctagaaaat ggcctcctga gatgacccct
     1861 c
//

340

Re: Формы, механизмы, энергия наномира - 84

https://www.ncbi.nlm.nih.gov/protein/10 … C0A790J015

https://www.ncbi.nlm.nih.gov/nuccore/740086722

Homo sapiens N-myristoyltransferase 1 (NMT1), mRNA
NCBI Reference Sequence: NM_021079.4
FASTA Graphics
Go to:
LOCUS       NM_021079               4916 bp    mRNA    linear   PRI 15-MAR-2015
DEFINITION  Homo sapiens N-myristoyltransferase 1 (NMT1), mRNA.
ACCESSION   NM_021079
VERSION     NM_021079.4
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 4916)
  AUTHORS   Thinon E, Serwa RA, Broncel M, Brannigan JA, Brassat U, Wright MH,
            Heal WP, Wilkinson AJ, Mann DJ and Tate EW.
  TITLE     Global profiling of co- and post-translationally N-myristoylated
            proteomes in human cells
  JOURNAL   Nat Commun 5, 4919 (2014)
   PUBMED   25255805
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 4916)
  AUTHORS   Morgan CR, Miglionico BV and Engen JR.
  TITLE     Effects of HIV-1 Nef on human N-myristoyltransferase 1
  JOURNAL   Biochemistry 50 (16), 3394-3403 (2011)
   PUBMED   21449607
  REMARK    GeneRIF: we propose a model of the Nef:NMT complex in which only
            the myristoyl moiety holds the two proteins together in complex and
            speculate that perhaps NMT chaperones Nef to the membrane and
            thereby protects the myristic acid group from the cytosol
REFERENCE   3  (bases 1 to 4916)
  AUTHORS   Takamune N, Gota K, Misumi S, Tanaka K, Okinaka S and Shoji S.
  TITLE     HIV-1 production is specifically associated with human NMT1 long
            form in human NMT isozymes
  JOURNAL   Microbes Infect. 10 (2), 143-150 (2008)
   PUBMED   18248763
  REMARK    GeneRIF: These results strongly suggest that HIV-1 production is
            specifically associated with hNMT1, particularly hNMT1(L), but not
            with hNMT2 in vivo, contributing to the understanding of a step in
            HIV-1 replication.
REFERENCE   4  (bases 1 to 4916)
  AUTHORS   Seaton KE and Smith CD.
  TITLE     N-Myristoyltransferase isozymes exhibit differential specificity
            for human immunodeficiency virus type 1 Gag and Nef
  JOURNAL   J. Gen. Virol. 89 (PT 1), 288-296 (2008)
   PUBMED   18089753
  REMARK    GeneRIF: Nef is preferentially myristoylated by NMT2, suggesting
            that selective inhibition of NMT2 may provide a novel means of
            blocking HIV virulence.
REFERENCE   5  (bases 1 to 4916)
  AUTHORS   Shrivastav A, Varma S, Saxena A, DeCoteau J and Sharma RK.
  TITLE     N-myristoyltransferase: a potential novel diagnostic marker for
            colon cancer
  JOURNAL   J Transl Med 5, 58 (2007)
   PUBMED   18021392
  REMARK    GeneRIF: N-myristoyltransferase may have a role in progression of
            colonic neoplasms
            Publication Status: Online-Only
REFERENCE   6  (bases 1 to 4916)
  AUTHORS   Duronio RJ, Reed SI and Gordon JI.
  TITLE     Mutations of human myristoyl-CoA:protein N-myristoyltransferase
            cause temperature-sensitive myristic acid auxotrophy in
            Saccharomyces cerevisiae
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 89 (9), 4129-4133 (1992)
   PUBMED   1570339
REFERENCE   7  (bases 1 to 4916)
  AUTHORS   Wice BM and Gordon JI.
  TITLE     A strategy for isolation of cDNAs encoding proteins affecting human
            intestinal epithelial cell growth and differentiation:
            characterization of a novel gut-specific N-myristoylated annexin
  JOURNAL   J. Cell Biol. 116 (2), 405-422 (1992)
   PUBMED   1530946
REFERENCE   8  (bases 1 to 4916)
  AUTHORS   Pal R, Reitz MS Jr, Tschachler E, Gallo RC, Sarngadharan MG and
            Veronese FD.
  TITLE     Myristoylation of gag proteins of HIV-1 plays an important role in
            virus assembly
  JOURNAL   AIDS Res. Hum. Retroviruses 6 (6), 721-730 (1990)
   PUBMED   2194551
REFERENCE   9  (bases 1 to 4916)
  AUTHORS   Bryant M and Ratner L.
  TITLE     Myristoylation-dependent replication and assembly of human
            immunodeficiency virus 1
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 87 (2), 523-527 (1990)
   PUBMED   2405382
REFERENCE   10 (bases 1 to 4916)
  AUTHORS   Mumby SM, Heukeroth RO, Gordon JI and Gilman AG.
  TITLE     G-protein alpha-subunit expression, myristoylation, and membrane
            association in COS cells
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 87 (2), 728-732 (1990)
   PUBMED   2153964
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BU849351.1, BC006569.2, AC116493.10, AC002117.2 and BC006538.2.
            On Dec 25, 2014 this sequence version replaced gi:39725674.
           
            Summary: Myristate, a rare 14-carbon saturated fatty acid, is
            cotranslationally attached by an amide linkage to the N-terminal
            glycine residue of cellular and viral proteins with diverse
            functions. N-myristoyltransferase (NMT; EC 2.3.1.97) catalyzes the
            transfer of myristate from CoA to proteins. N-myristoylation
            appears to be irreversible and is required for full expression of
            the biologic activities of several N-myristoylated proteins,
            including the alpha subunit of the signal-transducing guanine
            nucleotide-binding protein (G protein) GO (GNAO1; MIM 139311)
            (Duronio et al., 1992 [PubMed 1570339]).[supplied by OMIM, Nov
            2008].
           
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
           
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
           
            ##Evidence-Data-START##
            Transcript exon combination :: BC006538.2, AF043324.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA1965299, SAMEA1966682
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-13                BU849351.1         1-13
            14-517              BC006569.2         1-504
            518-518             AC116493.10        7458-7458           c
            519-1934            BC006569.2         506-1921
            1935-4015           AC002117.2         11044-13124
            4016-4916           BC006538.2         4003-4903
FEATURES             Location/Qualifiers
     source          1..4916
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="17"
                     /map="17q21.31"
     gene            1..4916
                     /gene="NMT1"
                     /gene_synonym="NMT"
                     /note="N-myristoyltransferase 1"
                     /db_xref="GeneID:4836"
                     /db_xref="HGNC:HGNC:7857"
                     /db_xref="HPRD:01187"
                     /db_xref="MIM:160993"
     exon            1..162
                     /gene="NMT1"
                     /gene_synonym="NMT"
                     /inference="alignment:Splign:1.39.8"
     CDS             32..1522
                     /gene="NMT1"
                     /gene_synonym="NMT"
                     /EC_number="2.3.1.97"
                     /note="alternative, short form NMT-S; long form, NMT-L;
                     type I N-myristoyltransferase; myristoyl-CoA:protein
                     N-myristoyltransferase 1"
                     /codon_start=1
                     /product="glycylpeptide N-tetradecanoyltransferase 1"
                     /protein_id="NP_066565.1"
                     /db_xref="CCDS:CCDS11494.1"
                     /db_xref="GeneID:4836"
                     /db_xref="HGNC:HGNC:7857"
                     /db_xref="HPRD:01187"
                     /db_xref="MIM:160993"
                     /translation="MADESETAVKPPAPPLPQMMEGNGNGHEHCSDCENEEDNSYNRG
                     GLSPANDTGAKKKKKKQKKKKEKGSETDSAQDQPVKMNSLPAERIQEIQKAIELFSVG
                     QGPAKTMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFTWDA
                     LDLGDRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLPQWHCGVRVVS
                     SRKLVGFISAIPANIHIYDTEKKMVEINFLCVHKKLRSKRVAPVLIREITRRVHLEGI
                     FQAVYTAGVVLPKPVGTCRYWHRSLNPRKLIEVKFSHLSRNMTMQRTMKLYRLPETPK
                     TAGLRPMETKDIPVVHQLLTRYLKQFHLTPVMSQEEVEHWFYPQENIIDTFVVENANG
                     EVTDFLSFYTLPSTIMNHPTHKSLKAAYSFYNVHTQTPLLDLMSDALVLAKMKGFDVF
                     NALDLMENKTFLEKLKFGIGDGNLQYYLYNWKCPSMGAEKVGLVLQ"
     misc_feature    122..124
                     /gene="NMT1"
                     /gene_synonym="NMT"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine. {ECO:0000250}; propagated from
                     UniProtKB/Swiss-Prot (P30419.2); phosphorylation site"
     misc_feature    170..172
                     /gene="NMT1"
                     /gene_synonym="NMT"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine. {ECO:0000269|PubMed:16964243,
                     ECO:0000269|PubMed:18669648, ECO:0000269|PubMed:20068231,
                     ECO:0000269|PubMed:21406692}; propagated from
                     UniProtKB/Swiss-Prot (P30419.2); phosphorylation site"
     exon            163..271
                     /gene="NMT1"
                     /gene_synonym="NMT"
                     /inference="alignment:Splign:1.39.8"
     exon            272..416
                     /gene="NMT1"
                     /gene_synonym="NMT"
                     /inference="alignment:Splign:1.39.8"
     exon            417..535
                     /gene="NMT1"
                     /gene_synonym="NMT"
                     /inference="alignment:Splign:1.39.8"
     exon            536..627
                     /gene="NMT1"
                     /gene_synonym="NMT"
                     /inference="alignment:Splign:1.39.8"
     STS             577..726
                     /gene="NMT1"
                     /gene_synonym="NMT"
                     /standard_name="MARC_16857-16858:1015861084:3"
                     /db_xref="UniSTS:268139"
     exon            628..744
                     /gene="NMT1"
                     /gene_synonym="NMT"
                     /inference="alignment:Splign:1.39.8"
     exon            745..915
                     /gene="NMT1"
                     /gene_synonym="NMT"
                     /inference="alignment:Splign:1.39.8"
     exon            916..1024
                     /gene="NMT1"
                     /gene_synonym="NMT"
                     /inference="alignment:Splign:1.39.8"
     exon            1025..1195
                     /gene="NMT1"
                     /gene_synonym="NMT"
                     /inference="alignment:Splign:1.39.8"
     exon            1196..1363
                     /gene="NMT1"
                     /gene_synonym="NMT"
                     /inference="alignment:Splign:1.39.8"
     exon            1364..1501
                     /gene="NMT1"
                     /gene_synonym="NMT"
                     /inference="alignment:Splign:1.39.8"
     exon            1502..4899
                     /gene="NMT1"
                     /gene_synonym="NMT"
                     /inference="alignment:Splign:1.39.8"
     STS             1524..1791
                     /gene="NMT1"
                     /gene_synonym="NMT"
                     /standard_name="STS-M86707"
                     /db_xref="UniSTS:26977"
     STS             1723..1823
                     /gene="NMT1"
                     /gene_synonym="NMT"
                     /standard_name="SHGC-34291"
                     /db_xref="UniSTS:3300"
     STS             3559..4441
                     /gene="NMT1"
                     /gene_synonym="NMT"
                     /standard_name="NMT1_8508"
                     /db_xref="UniSTS:467801"
     STS             3791..3914
                     /gene="NMT1"
                     /gene_synonym="NMT"
                     /standard_name="RH70326"
                     /db_xref="UniSTS:46123"
     STS             4083..4218
                     /gene="NMT1"
                     /gene_synonym="NMT"
                     /standard_name="RH66609"
                     /db_xref="UniSTS:26300"
     STS             4738..4861
                     /gene="NMT1"
                     /gene_synonym="NMT"
                     /standard_name="WI-13574"
                     /db_xref="UniSTS:74772"
ORIGIN     
        1 ggggcgcgga gccctgctct cgcaactcaa gatggcggac gagagtgaga cagcagtgaa
       61 gccgccggca cctccgctgc cgcagatgat ggaagggaac gggaacggcc atgagcactg
      121 cagcgattgc gagaatgagg aggacaacag ctacaaccgg ggtggtttga gtccagccaa
      181 tgacactgga gccaaaaaga agaaaaagaa acaaaaaaag aagaaagaaa aaggcagtga
      241 gacagattca gcccaggatc agcctgtgaa gatgaactct ttgccagcag agaggatcca
      301 ggaaatacag aaggccattg agctgttctc agtgggtcag ggacctgcca aaaccatgga
      361 ggaggctagc aagcgaagct accagttctg ggatacgcag cccgtcccca agctgggcga
      421 agtggtgaac acccatggcc ccgtggagcc tgacaaggac aatatccgcc aggagcccta
      481 caccctgccc cagggcttca cctgggatgc tttggacctg ggcgatcgtg gtgtgctaaa
      541 agaactgtac accctcctga atgagaacta tgtggaagat gatgacaaca tgttccgatt
      601 tgattattcc ccggagtttc ttttgtgggc tctccggcca cccggctggc tcccccagtg
      661 gcactgtggg gttcgagtgg tctcaagtcg gaaattggtt gggttcatta gcgccatccc
      721 agcaaacatc catatctatg acacagagaa gaagatggta gagatcaact tcctgtgtgt
      781 ccacaagaag ctgcgttcca agagggttgc tccagttctg atccgagaga tcaccaggcg
      841 ggttcacctg gagggcatct tccaagcagt ttacactgcc ggggtggtac taccaaagcc
      901 cgttggcacc tgcaggtatt ggcatcggtc cctaaaccca cggaagctga ttgaagtgaa
      961 gttctcccac ctgagcagaa atatgaccat gcagcgcacc atgaagctct accgactgcc
     1021 agagactccc aagacagctg ggctgcgacc aatggaaaca aaggacattc cagtagtgca
     1081 ccagctcctc accaggtact tgaagcaatt tcaccttacg cccgtcatga gccaggagga
     1141 ggtggagcac tggttctacc cccaggagaa tatcatcgac actttcgtgg tggagaacgc
     1201 aaacggagag gtgacagatt tcctgagctt ttatacgctg ccctccacca tcatgaacca
     1261 tccaacccac aagagtctca aagctgctta ttctttctac aacgttcaca cccagacccc
     1321 tcttctagac ctcatgagcg acgcccttgt cctcgccaaa atgaaagggt ttgatgtgtt
     1381 caatgcactg gatctcatgg agaacaaaac cttcctggag aagctcaagt ttggcatagg
     1441 ggacggcaac ctgcagtatt acctttacaa ttggaaatgc cccagcatgg gggcagagaa
     1501 ggttggactg gtgctacaat aaccagtcac cagtgcgatt ctggataaag ccactgaaaa
     1561 ttcgaaccag gaaatggaac cccaccactg ttggtccaat tttcacacac gtgagaatcc
     1621 ctggcaaagg gagcagaact gaaccggctt taccaaaccg ccagcgaact tgacaattgt
     1681 attgcgatgg cgtgggctgc gtgacgtcac ctccggtcgt gtctctggtc tccgtgtttt
     1741 ccagttaatt acatcctcat gcagccgtga tcaagggaat gtaactgctg aaaactagct
     1801 cgtgattggc atataatgga gttaacgggt gaataataaa agtatatata tatattatat
     1861 atatataaat attttaaata tctttcatgt tccaaatgta caaggatgtt tggtctttaa
     1921 tgaaaagctg aatccagatc attcctcaga atgaggaccc gaggacagtg gcagacagac
     1981 gcgttggcac agttcatggt ttcctccaga ggagacattg gcttatcatg gggaaaaaga
     2041 ggatctggag aacctcatcc agctcccctt ctgaatcagc tgggatgact ggctttgaga
     2101 aggaagggaa gatggaacag gctcagatct catgggatag cacgtggagc tcttggctgg
     2161 ggctgaccct gggcagggac tttcctgcag ggccagacct gcctgcattc tgagacaaag
     2221 caatggacgg tccgcagaag cagacctcat tgattgagtc ctttcttcca tccccttggc
     2281 ctgctccctg taggaagtca tcctgccaac tgatttaaaa gggctcttta gccagttgtt
     2341 gccaacctta tagggatgag tcccctgtga gattttgctt ttccactgcc tgggatgatg
     2401 cagtttgaag aggcccttgg acctccttgt aacatcaggg acctttggag accattatca
     2461 gtgtaagccc tgcttagctc atcttagagc aaagagccag caccctgatg tccctggggt
     2521 ggctaggcag gagtggcgtg gggccaatac ccagacccct tcagccacca gcccctggcc
     2581 tgtgccttcc aacccattag ccatttcttg ttgtgcccct ttccaagata cagcctgcaa
     2641 gtggtagcaa gaagtgatta gaggcagatc tggacttggc aacagaagtg gtttcccatc
     2701 tccattgtct gagtctgatt ttcgctgatg ctgttttgtg gatttttgtg gtagtgatgg
     2761 ttgtcagtgc tgccagtttc ccaaaacgta atcaagcctc tggtcacatg gctgtcgatg
     2821 taggcattct ggagtggtgt tcagccaagt gaccgggcaa aattgggctg tgaaattgta
     2881 cttccaggct tggatgtaat ttttgctcta gagagaagca agtggtggga aggaggtagc
     2941 atgacgtgtg gtgtgcgggt ttccttgctg ccgtcacctc tccgctcata caggaatgaa
     3001 gccttagcca ggaggccagg ctcagccctg tgccactcac cgaagccact ttctacaggc
     3061 cagcaggggc ttgttgcagg ctgtgggttt tggtgtggtt tgtcagaggc taattctgca
     3121 gagtttccaa aaccagaaga catcgtatgc ttgggatggg ggccgtgcca cccgtgggaa
     3181 tgctgcccgc tctgcagact gctgctagag ccagcaactc cactaaggtg gattttcatc
     3241 aggggcctgc agggccctcc cttttcccat tgttcctgcg ctgcaaattg caggccccag
     3301 caatcgtgac tgacgtttgc tccttgactc caagaaactg agaccaaaga agctgctgtt
     3361 cttagcaaga tgcgcactgc attccacagg tgggaggagt cggagaggca ggggcttgct
     3421 ttgcagcccc acagacaaca gttgcacagt gcctcaagcc ccagagtggc tcaccctgtc
     3481 cagacctttg aggatatcaa aggacaaagt gcccaagtct ttcctacctt gggggaacct
     3541 ggaacttgga aaggctccct gtcctagtct tgatctgttc tgggccaggt cccagcttga
     3601 gctgcctctg agatttgggc tgtgcggatc tctggagtga gctctgtttc ggttgaccca
     3661 ggtcatggaa tggaaacggt gaggccccag tggctgttct ggaagaaaca gatctcctgg
     3721 caaaggcccc agcatctccc tcactgaaac caggtggccg gctcctcgga ctctgcttta
     3781 tgttgcggtg agaactctgc ccaggtgtgc agggtttggc ttgtgggctg cttgctgctc
     3841 atctgatttt tgtcccagta gtccctgcgt tcttcattca accccttctg ggacttcagc
     3901 tcagagagca ccatcccggg ggtcagggcc tccccacagg agccctgcag tgtggtagcg
     3961 ccatggctgt ctcaaaccaa gcaaaggaag gaccctgagg ccttcacgct aaccgtcctc
     4021 gagcaactgc tgttggaagg cctccctggg cctggccccc accctctgcc acccagtcct
     4081 cccagctgcc atgtttcaaa gacgaccttt acctcctgcc tttggattga ctctgcattt
     4141 gaccacggac tccagtctgt gtgtagggag agagctgagt aggaggcctc cactccggat
     4201 cgaggcctgt atagggctcg tttccccaca catgcctatt tctgaagagg cttctgtctt
     4261 atttgaaggc cagcccacac ccagctactt taacaccagg tttatggaaa atgtcaggcc
     4321 ttccccacaa ctcctgtcta actgctgtcg cccccctact tgctggctct cagaagccta
     4381 ggggagtccc tgtggtcctg aattctttcc ccaaagacga ccagcattta accaacctaa
     4441 gggcccaaag gccttggaca actgcatgga gctgcactct aggagaagga ggggaaccag
     4501 atgttagatc aggggaggga gcaggagtgt ccctcccgtc agtgcctacc cacctgtgag
     4561 gcagccttct gatggcctgg cccaccttcc ccagaaccag gggaggcctg aggcttcagt
     4621 tttactctgc tgcaaaatga aggcgggcct gcaagccgac tacacctacg gaggctgttg
     4681 aggacaattt cattccatta aattaaaaaa tactgactgg ctggcaggca ggtgccatgt
     4741 ctgggaacag ggacggggga gcttcacctt tttgtcttgg cttttctttg ggctgtgggg
     4801 gggcatccat ttccagggtc ggggaggaaa taccaaatgc attgttgttc tgctcaatac
     4861 atctcacttg tttctaataa agaaagcagc tgaacaaaaa aaaaaaaaaa aaaaaa
//