151

Re: Рекорды сверхдлинных спиралей белковых молекул

Заказ 2017-11-27_10:

https://www.ncbi.nlm.nih.gov/nuccore/11 … mask=65536

>ENA|OLQ15353
atgattcttgtggtggtggtggtggtggtggtggtggtggtggtggtggtgctggtggtg
ctggtggtgctggtggtgctggtggtgctggtgctggtggtggtggtggtgctgctggtg
gtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctg
gtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtg
ctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtg
gtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctg
gtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtg
ctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtg
gtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctg
gtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtg
ctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtg
gtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctg
gtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtg
ctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtg
gtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctg
gtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtg
ctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtg
gtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctg
gtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtg
ctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtg
gtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctg
gtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtg
ctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtg
gtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctg
gtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtg
ctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtg
gtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctg
gtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtg
ctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtg
gtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctg
gtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtg
ctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtg
gtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctg
gtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtg
ctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtg
gtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctg
gtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtg
ctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtg
gtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctg
gtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtg
ctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtg
gtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctg
gtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtg
ctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtg
gtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctg
gtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtg
ctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtg
gtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctg
gtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtg
ctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtg
gtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctg
gtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtg
ctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtg
gtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctg
gtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtg
ctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtg
gtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctggtggtgctg
gtggtgctggtggtgctggtggtgctgncggcggcggcggcggcggcggcccaccaccac
caccaccaccaccaccaccaccaccaccaaaacgactgttaccactgctag

Результат:

https://img-fotki.yandex.ru/get/517076/158289418.4ab/0_187460_8b193b20_XL.png

Развернуто:

https://img-fotki.yandex.ru/get/477847/158289418.4ab/0_187461_35841226_XL.png
Оригинал: https://img-fotki.yandex.ru/get/477847/ … 6_orig.png

Очень любопытно посмотреть на результат работы алгоритма от Виктории Соколик:

https://img-fotki.yandex.ru/get/897385/158289418.4ab/0_187462_e152e392_XL.gif
Оригинал: https://img-fotki.yandex.ru/get/897385/ … 2_orig.gif

Фрагмент:

https://img-fotki.yandex.ru/get/373630/158289418.4ab/0_187463_396c6ad8_orig.gif
По алгоритму Виктории Соколик построился маленький фрагмент альфа-спирали, но её расположение не совпадает с расположением альфа-спирального участка по таблице Кушелева. Любопытно, что по кодам альфа-спирали у Виктории альфа-спираль не построилась...

152

Re: Рекорды сверхдлинных спиралей белковых молекул

Формы, механизмы, энергия наномира. Сообщение 93 702

Многослойные спирали и мезо-механизмы

Рекорды сверхдлинных спиралей белковых молекул

Online service PROTEIN PICOTECHNOLOGY

Skype:

[16.12.2017 3:47:47] Va12220(Valqwa): усечение буду делать завтра к вечеру
[16.12.2017 10:50:33] Кушелев Александр Юрьевич: Замечательно!
[0:50:35] Кушелев Александр Юрьевич: Привет! Что-то  названия файлов не те и на компактной картинке не то в верхней строке.
Имя файла без номера: LJOW01001018P_01.png. А номер нужен.


https://img-fotki.yandex.ru/get/896238/158289418.4b3/0_189610_e6c73bf1_orig.png

[0:51:18] Кушелев Александр Юрьевич: А в первой строке вместо номера название папки. Это не нужно. Нужен номер и идентификатор. Папку тут указывать не нужно.
[1:32:24] Кушелев Александр Юрьевич: А другой gbk-файл обработался вроде лучше. Номера в названиях файлов есть. Но на картинке лишняя информация. Имя папки. Его желательно убрать.
[2:18:49] Кушелев Александр Юрьевич: Этот файл считается с ошибкой. Будем надеяться, что ошибка в NCBI:

https://img-fotki.yandex.ru/get/914565/158289418.4b3/0_189619_c63c4c30_XL.png
Оригинал: https://img-fotki.yandex.ru/get/914565/ … 0_orig.png

[2:19:30] Кушелев Александр Юрьевич: gbk взят отсюда: https://www.ncbi.nlm.nih.gov/protein/PI … B75001U015
[2:20:01] Кушелев Александр Юрьевич: Кстати, похоже сегодня удалось сделать крутое научное открытие: http://nanoworld.org.ru/topic/1881/
[2:20:09] Кушелев Александр Юрьевич: Поздравляю! Это наша удача.
[5:27:30] Va12220(Valqwa): сделал усечение. подчистил названия файлов.
проверь на нескольких файлах
[5:28:15] Va12220(Valqwa):
Кушелев: Кстати, похоже сегодня удалось сделать крутое научное открытие: http://nanoworld.org.ru/topic/1881/
Поздравляю! Это наша удача.
Va12220(Valqwa): забыл на форуме упомянуть меня
[9:29:57] Кушелев Александр Юрьевич: "Сам себя не похвалишь, никто не похвалит". А ты же зарегистрирован на форуме. Давай обсудим нашу удачу. В чём проблема?

https://img-fotki.yandex.ru/get/963786/158289418.4b3/0_189616_f8fa470_XL.png

Развёрнуто:

https://img-fotki.yandex.ru/get/509885/158289418.4b3/0_189618_9027851c_XL.png
Оригинал: https://img-fotki.yandex.ru/get/509885/ … c_orig.png

Кстати, мне уже попадались аналогичные и даже "более такие же", "более чем" структуры:

https://img-fotki.yandex.ru/get/896238/158289418.4a6/0_186ba1_52a77613_XL.png

Развернуто:

https://img-fotki.yandex.ru/get/872132/158289418.4a6/0_186ba2_ccc2630e_XL.png
Оригинал: https://img-fotki.yandex.ru/get/872132/ … e_orig.png

Эта структура вообще может быть Т-конструкцией из двухслойной спирали.

Сначала строится верхняя черта Т из 310-спирали длиной 38 аминокислотных остатков. Затем поверх нее укладывается второй слой (пи-спираль длиной 17 АО), покрывая процентов 20...25 310-спирали. Потом идёт шпилька из 310-спирали длиной 8 АО (примерно 0.21 от "верхней черты"). Далее обратным ходом на шпильку укладывается 19 АО пи-спирали. После этого строится 28 АО альфа-спирали, которая может идти под любым углом, т.е. от нуля до 180 к первоначальной "черте" или к шпильке. Кстати, шпилька тоже может быть расположена под любым углом к "черте". Далее идёт 310-спираль длиной 45 АО и альфа-спираль длиной 53 АО. Последние три участка - это сверхдлинная прямая спираль (28+45+53 АО), которая тоньше в средней части. Наконец, идёт пи-спираль, например, поверх альфа-спрали и какой-то хитрый узел. Всё это может иметь форму рогатки из двухслойной пи-альфа-спирали на всех трех концах. Может быть и сравнительно  низкочастотной резонансной системой, похожий на U-образный музыкальный камертон. С этим интересно было бы разобраться...

***

https://img-fotki.yandex.ru/get/5007/158289418.4a7/0_186bb7_ec7a55f4_XL.png

Развернуто:

https://img-fotki.yandex.ru/get/5007/158289418.4a7/0_186bb8_14486e2d_XL.png
Оригинал: https://img-fotki.yandex.ru/get/5007/15 … d_orig.png
Подробнее: http://nanoworld.org.ru/topic/1656/page/14/

Этот белок тоже может состоять из двухслойных спиралей, но верхний слой может быть образован не фундаментальной, а программной спиралью. У меня и раньше закрадывалось предположение, что программная 35-спираль может идти верхним слоем по отношению даже к пи-спирали, не говоря о более тонких спиралях.

https://img-fotki.yandex.ru/get/370294/158289418.4a7/0_186be0_27d7b96f_XL.png
Подробнее: http://nanoworld.org.ru/topic/1656/page/14/

А этот белок содержит длинные участки 310-альфа-спиралей, пи-спиралей и программных 35-спиралей. Я не удивлюсь, если в его структуре попадётся не только участок двухслойной, но и участок трехслойной альфа-пи-35-спирали.

https://img-fotki.yandex.ru/get/897139/158289418.4a5/0_1863b2_62631aa0_XL.png
Подробнее: http://nanoworld.org.ru/topic/1656/page/12/

Здесь мы тоже видим участок 310-спирали, за ним сразу пи-спираль, а за ним 35-спираль. Это может быть трехслойный участок 310-пи-35-спирали. А может и нет. Надо проверять...

https://img-fotki.yandex.ru/get/368754/158289418.4a8/0_186cc6_95a06491_orig.png
Подробнее: http://nanoworld.org.ru/topic/1656/page/14/

Если это - система противонаправленных альфа- и бета-спиральных участков, образующих гигантскую трубу, то это:

https://img-fotki.yandex.ru/get/896349/158289418.4a5/0_1863ba_ccc834d4_XL.png

Развернуто:

https://img-fotki.yandex.ru/get/373339/158289418.4a5/0_1863bb_2169fd79_XL.png
Подробнее: http://nanoworld.org.ru/topic/1656/page/12/

Может быть либо антинаправленными участками альфа-спиралей и двухслойных 310-пи-спиралей, образующих гигантскую трубу, либо рёберным многогранником, в частности 6-угольной пирамидой, основание которой образовано альфа-спиральными участками, а наклонные ребра - двухслойными 310-пи-спиралями. При этом пирамида может быть лишь одним из крайних состояний некого манипулятора, который может развернуться в 6-конечную "звезду". Это нужно моделировать в 3D. Тогда может появиться определенность и ясность.

https://img-fotki.yandex.ru/get/875526/158289418.4a5/0_18649d_3b97c25e_orig.png
Подробнее: http://nanoworld.org.ru/topic/1656/page/12/

Это уже скорее всего гигантская труба из противонаправленных альфа-спиральных и двухслойных 310-пи-спиральных участков. Но тоже надо проверять.

https://img-fotki.yandex.ru/get/892702/158289418.4af/0_188379_96ba8f74_orig.png
Подробнее: http://nanoworld.org.ru/topic/1699/page/74/

Эти экзотические структуры могут оказаться очень интересными мезо-механизмами (что-то среднее между большой третичной и малой четвертичной структурой), включающими в себя многослойные спирали.

153

Re: Рекорды сверхдлинных спиралей белковых молекул

Формы, механизмы, энергия наномира. Сообщение 93 881

Определим структуры всех белков человека к Новому, 2018-ому году?

Число разновидностей белков человека около 5 000 000.

За всю историю развития науки и техники определено около 100 000 белковых структур (половина неправильно). На это истрачено более миллиарда USD.

https://img-fotki.yandex.ru/get/198860/158289418.3e0/0_176329_6d9df850_L.gif
Пример пикотехнологической 3D-модели белка.

Кушелев: На данный момент база белковых структур "Human Genome Protein", расположенная по этим адресам:

Part 1: https://cloud.mail.ru/public/BJeH/PdR6tFSsR

Part 2: https://cloud.mail.ru/public/Jxkq/Yt3GQAcC8

содержит структуры белков, закодированных

5, 7, 8, 9, 11, 12, 13, 14, 16, 17, 18, 19, 20, 21, 22, 23(X), 24(Y)-хромосомами человека:
https://img-fotki.yandex.ru/get/894414/158289418.4b5/0_189a97_82a0444c_orig.png

Примеры вторичных структур белка в компактном и развёрнутом виде:

https://img-fotki.yandex.ru/get/897810/158289418.4b6/0_189e73_8f3b4a12_orig.png

Развернуто:

https://img-fotki.yandex.ru/get/893753/158289418.4b7/0_18a055_f5f116d2_XL.png

***

https://img-fotki.yandex.ru/get/516365/158289418.4b7/0_189ecf_13af3e92_orig.png

https://img-fotki.yandex.ru/get/879536/158289418.4b7/0_189f2f_d2a84234_XL.png

https://img-fotki.yandex.ru/get/877700/158289418.4b7/0_18a065_70b30230_orig.png

https://img-fotki.yandex.ru/get/914553/158289418.4b7/0_18a069_6ec5aef6_orig.png






https://img-fotki.yandex.ru/get/876984/158289418.4b7/0_18a06c_288cc96f_orig.png

https://img-fotki.yandex.ru/get/874316/158289418.4b8/0_18a070_5b715cbf_orig.png

https://img-fotki.yandex.ru/get/875526/158289418.4b8/0_18a072_8eef4d58_orig.png

Укрупнение:

https://img-fotki.yandex.ru/get/874316/158289418.4b8/0_18a073_e57bd51_orig.png

https://img-fotki.yandex.ru/get/897810/158289418.4b8/0_18a0ba_e3f74559_orig.png

https://img-fotki.yandex.ru/get/896349/158289418.4b9/0_18a0fd_f166188_orig.png

154

Re: Рекорды сверхдлинных спиралей белковых молекул

Формы, механизмы, энергия наномира. Сообщение 94 081

3D модель "монстра" первой хромосомы (5207 АО)

https://img-fotki.yandex.ru/get/476282/158289418.4bc/0_18a56a_5930b399_orig.gif

Скрипт Кушелева, с помощью которого был построен фрагмент "монстра" первой хромосомы человека.

-- Monster of the first human chromosome (5207 amino acids)
-- Nanoworld Lab. Alexander Kushelev
-- http://nanoworld.org.ru
p = #()
angx=#(10,0,0,10,10); angy=#(30,120,30,30,30); angz=#(97,120,-60,80,80)
--dx=#(2,1.5,1.6,2,2); dy=#(0.6,1,0.8,1,0.6); dz=#(-0.45,0,-0.6,-0.15,-0.45)
dx=#(1.5,1,1.6,1.5,1.5); dy=#(0,-2,-1.5,0,0); dz=#(1.2,-1,-1.2,1.2,1.2)
kk=#(1,3,1,1,1,1,1,4,4,3,1,3,4,3,3,1,1,1,1,2,4,3,3,3,3,2,3,3,2,3,3,3,3,4,3,1,2,1,1,1,1,3,3,1,3,1,2,1,1,3,
1,3,3,1,1,3,3,1,1,3,3,3,3,1,1,3,3,4,3,3,1,3,1,2,2,1,1,1,1,1,1,1,4,4,3,1,3,1,3,3,1,1,1,1,2,4,3,3,3,3,
4,3,3,2,3,3,3,3,4,3,1,3,1,1,1,1,1,3,3,3,1,2,1,1,3,1,1,3,1,1,3,3,1,4,1,3,3,3,1,1,3,3,1,3,3,1,3,1,2,2,
1,1,1,1,1,1,1,4,4,1,2,2,1,3,3,1,1,1,1,2,4,3,3,3,3,2,3,3,1,3,3,3,3,1,3,1,1,1,1,1,3,2,3,1,3,3,2,1,1,3,
3,3,3,1,3,3,3,1,4,2,3,3,3,1,1,4,1,4,1,3,3,1,2,3,3,2,1,1,3,3,3,1,2,3,3,3,4,3,3,3,3,1,2,2,1,1,1,1,1,1,
1,4,4,3,1,3,4,3,3,1,1,1,1,2,4,3,3,3,3,2,3,3,2,3,3,3,3,4,3,1,2,1,1,1,1,3,3,1,3,1,2,1,1,3,1,3,3,1,1,3,
3,1,1,3,3,3,3,1,1,3,3,4,3,3,1,3,1,2,2,1,1,1,1,1,1,1,4,4,3,1,3,1,3,3,1,1,1,1,2,4,3,3,3,3,4,3,3,2,3,3,
3,3,4,3,1,3,1,1,1,1,1,3,3,3,1,2,1,1,3,1,1,3,1,1,3,3,1,4,1,3,3,3,1,1,3,3,1,3,3,1,3,1,2,2,1,1,1,1,1,1,
1,4,4,1,2,2,1,3,3,1,1,1,1,2,4,3,3,3,3,2,3,3,1,3,3,3,3,1,3,1,1,1,1,1,3,2,3,1,3,3,2,1,1,3,3,3,3,1,3,3,
3,1,4,2,3,3,3,1,1,4,1,4,1,3,3,1,2,3,3,2,1,1,3,3,3,1,2,3,3,3,4,3,3,3,3,1,2,2,1,1,1,1,1,1,1,4,4,3,1,3,
4,3,3,1,1,1,1,2,4,3,3,3,3,2,3,3,2,3,3,3,3,4,3,1,2,1,1,1,1,3,3,1,3,1,2,1,1,3,1,3,3,1,1,3,3,1,1,3,3,3,
3,1,1,3,3,4,3,3,1,3,1,2,2,1,1,1,1,1,1,1,4,4,3,1,3,1,3,3,1,1,1,1,2,4,3,3,3,3,4,3,3,2,3,3,3,3,4,3,1,3,
1,1,1,1,1,3,3,3,1,2,1,1,3,1,1,3,1,1,3,3,1,4,1,3,3,3,1,1,3,3,1,3,3,1,3,1,2,2,1,1,1,1,1,1,1,4,4,1,2,2,
1,3,3,1,1,1,1,2,4,3,3,3,3,2,3,3,1,3,3,3,3,1,3,1,1,1,1,1,3,2,3,1,3,3,2,1,1,3,3,3,3,1,3,3,1,1,4,2,3,3,
3,1,1,4,1,4,1,3,3,1,2,3,3,2,1,1,3,3,3,1,2,3,3,3,4,3,3,3,3,1,2,2,1,1,1,1,1,1,1,4,4,3,1,3,4,3,3,1,1,1,
1,2,4,3,3,3,3,2,3,3,2,3,3,3,3,4,3,1,2,1,1,1,1,3,3,1,3,1,2,1,1,3,1,3,3,1,1,3,3,1,1,3,3,3,3,1,1,3,3,4,
3,3,1,3,1,2,2,1,1,1,1,1,1,1,4,4,3,1,3,1,3,3,1,1,1,1,2,4,3,3,3,3,4,3,3,2,3,3,3,3,4,3,1,3,1,1,1,1,1,3,
3,3,1,2,1,1,3,1,1,3,1,1,3,3,1,4,1,3,3,3,1,1,3,3,1,3,3,1,3,1,2,2,1,1,1,1,1,1,1,4,4,1,2,2,1,3,3,1,1,1,
1,2,4,3,3,3,3,2,3,3,1,3,3,3,3,1,3,1,1,1,1,1,3,2,3,1,3,3,2,1,1,3,3,3,3,1,3,3,3,1,4,2,3,3,3,1,1,4,1,4,
1,3,3,1,2,3,3,2,1,1,3,3,3,1,2,3,3,3,4,3,3,3,3,1,2,2,1,1,1,1,1,1,1,4,4,3,1,3,4,3,3,1,1,1,1,2,4,3,3,3,
3,2,3,3,2,3,3,3,3,4,3,1,2,1,1,1,1,3,3,1,3,1,2,1,1,3,1,3,3,1,1,3,3,1,1,3,3,3,3,1,1,3,3,4,3,3,1,3,1,2,
2,1,1,1,1,1,1,1,4,4,3,1,3,1,3,3,1,1,1,1,2,4,3,3,3,3,4,3,3,2,3,3,3,3,4,3,1,3,1,1,1,1,1,3,3,3,1,2,1,1,
3,1,1,3,1,1,3,3,1,4,1,3,3,3,1,1,3,3,1,3,3,1,3,1,2,2,1,1,1,1,1,1,1,4,4,1,2,2,1,3,3,1,1,1,1,2,4,3,3,3,
3,2,3,3,1,3,3,3,3,1,3,1,1,1,1,1,3,2,3,1,3,3,2,1,1,3,3,3,3,1,3,3,1,1,4,2,3,3,3,1,1,4,1,4,1,3,3,1,2,3,
3,2,1,1,3,3,3,1,2,3,3,3,4,3,3,3,3,1,2,2,1,1,1,1,1,1,1,4,4,3,1,3,4,3,3,1,1,1,1,2,4,3,3,3,3,2,3,3,2,3,
3,3,3,4,3,1,2,1,1,1,1,3,3,1,3,1,2,1,1,3,1,3,3,1,1,3,3,1,1,3,3,3,3,1,1,3,3,4,3,3,1,3,1,2,2,1,1,1,1,1,
1,1,4,4,3,1,3,1,3,3,1,1,1,1,2,4,3,3,3,3,4,3,3,2,3,3,3,3,4,3,1,3,1,1,1,1,1,3,3,3,1,2,1,1,3,1,1,3,1,1,
3,3,1,4,1,3,3,3,1,1,3,3,1,3,3,1,3,1,2,2,1,1,1,1,1,1,1,4,4,1,2,2,1,3,3,1,1,1,1,2,4,3,3,3,3,2,3,3,1,3,
3,3,3,1,3,1,1,1,1,1,3,2,3,1,3,3,2,1,1,3,3,3,3,1,3,3,1,1,4,2,3,3,3,1,1,4,1,4,1,3,3,1,2,3,3,2,1,1,3,3,
3,1,2,3,3,3,4,3,3,3,3,1,2,2,1,1,1,1,1,1,1,4,4,3,1,3,4,3,3,1,1,1,1,2,4,3,3,3,3,2,3,3,2,3,3,3,3,4,3,1,
2,1,1,1,1,3,3,1,3,1,2,1,1,3,1,3,3,1,1,3,3,1,1,3,3,3,3,1,1,3,3,4,3,3,1,3,1,2,2,1,1,1,1,1,1,1,4,4,3,1,
3,1,3,3,1,1,1,1,2,4,3,3,3,3,4,3,3,2,3,3,3,3,4,3,1,3,1,1,1,1,1,3,3,3,1,2,1,1,3,1,1,3,1,1,3,3,1,4,1,3,
3,3,1,1,3,3,1,3,3,1,3,1,2,2,1,1,1,1,1,1,1,4,4,1,2,2,1,3,3,1,1,1,1,2,4,3,3,3,3,2,3,3,1,3,3,3,3,1,3,1,
1,1,1,1,3,2,3,1,3,3,2,1,1,3,3,3,3,1,3,3,1,1,4,2,3,3,3,1,1,4,1,4,1,3,3,1,2,3,3,2,1,1,3,3,3,1,2,3,3,3,
4,3,3,3,3,1,2,2,1,1,1,1,1,1,1,4,4,3,1,3,4,3,3,1,1,1,1,2,4,3,3,3,3,2,3,3,2,3,3,3,3,4,3,1,2,1,1,1,1,3,
3,1,3,1,2,1,1,3,1,3,3,1,1,3,3,1,1,3,3,3,3,1,1,3,3,4,3,3,1,3,1,2,2,1,1,1,1,1,1,1,4,4,3,1,3,1,3,3,1,1,
1,1,2,4,3,3,3,3,4,3,3,2,3,3,3,3,4,3,1,3,1,1,1,1,1,3,3,3,1,2,1,1,3,1,1,3,1,1,3,3,1,4,1,3,3,3,1,1,3,3,
1,3,3,1,3,1,2,2,1,1,1,1,1,1,1,4,4,1,2,2,1,3,3,1,1,1,1,2,4,3,3,3,3,2,3,3,1,3,3,3,3,1,3,1,1,1,1,1,3,2,
3,1,3,3,2,1,1,3,3,3,3,1,3,3,1,1,4,2,3,3,3,1,1,4,1,4,1,3,3,1,2,3,3,2,1,1,3,3,3,1,2,3,3,3,4,3,3,3,3,1,
2,2,1,1,1,1,1,1,1,4,4,3,1,3,4,3,3,1,1,1,1,2,4,3,3,3,3,2,3,3,2,3,3,3,3,4,3,1,2,1,1,1,1,3,3,1,3,1,2,1,
1,3,1,3,3,1,1,3,3,1,1,3,3,3,3,1,1,3,3,4,3,3,1,3,1,2,2,1,1,1,1,1,1,1,4,4,3,1,3,1,3,3,1,1,1,1,2,4,3,3,
3,3,4,3,3,2,3,3,3,3,4,3,1,3,1,1,1,1,1,3,3,3,1,2,1,1,3,1,1,3,1,1,3,3,1,4,1,3,3,3,1,1,3,3,1,3,3,1,3,1,
2,2,1,1,1,1,1,1,1,4,4,1,2,2,1,3,3,1,1,1,1,2,4,3,3,3,3,2,3,3,1,3,3,3,3,1,3,1,1,1,1,1,3,2,3,1,3,3,2,1,
1,3,3,3,3,1,3,3,1,1,4,2,3,3,3,1,1,4,1,4,1,3,3,1,2,3,3,2,1,1,3,3,3,1,2,3,3,3,4,3,3,3,3,1,2,2,1,1,1,1,
1,1,1,4,4,3,1,3,4,3,3,1,1,1,1,2,4,3,3,3,3,2,3,3,2,3,3,3,3,4,3,1,2,1,1,1,1,3,3,1,3,1,2,1,1,3,1,3,3,1,
1,3,3,1,1,3,3,3,3,1,1,3,3,4,3,3,1,3,1,2,2,1,1,1,1,1,1,1,4,4,3,1,3,1,3,3,1,1,1,1,2,4,3,3,3,3,4,3,3,2,
3,3,3,3,4,3,1,3,1,1,1,1,1,3,3,3,1,2,1,1,3,1,1,3,1,1,3,3,1,4,1,3,3,3,1,1,3,3,1,3,3,1,3,1,2,2,1,1,1,1,
1,1,1,4,4,1,2,2,1,3,3,1,1,1,1,2,4,3,3,3,3,2,3,3,1,3,3,3,3,1,3,1,1,1,1,1,3,2,3,1,3,3,2,1,1,3,3,3,3,1,
3,3,1,1,4,2,3,3,3,1,1,4,1,4,1,3,3,1,2,3,3,2,1,1,3,3,3,1,2,3,3,3,4,3,3,3,3,1,2,2,1,1,1,1,1,1,1,4,4,3,
1,3,4,3,3,1,1,1,1,2,4,3,3,3,3,2,3,3,2,3,3,3,3,4,3,1,2,1,1,1,1,3,3,1,3,1,2,1,1,3,1,3,3,1,1,3,3,1,1,3,
3,3,3,1,1,3,3,4,3,3,1,3,1,2,2,1,1,1,1,1,1,1,4,4,3,1,3,1,3,3,1,1,1,1,2,4,3,3,3,3,4,3,3,2,3,3,3,3,4,3,
1,3,1,1,1,1,1,3,3,3,1,2,1,1,3,1,1,3,1,1,3,3,1,4,1,3,3,3,1,1,3,3,1,3,3,1,3,1,2,2,1,1,1,1,1,1,1,4,4,1,
2,2,1,3,3,1,1,1,1,2,4,3,3,3,3,2,3,3,1,3,3,3,3,1,3,1,1,1,1,1,3,2,3,1,3,3,2,1,1,3,3,3,3,1,3,3,1,1,4,2,
3,3,3,1,1,4,1,4,1,3,3,1,2,3,3,2,1,1,3,3,3,1,2,3,3,3,4,3,3,3,3,1,2,2,1,1,1,1,1,1,1,4,4,3,1,3,4,3,3,1,
1,1,1,2,4,3,3,3,3,2,3,3,2,3,3,3,3,4,3,1,2,1,1,1,1,3,3,1,3,1,2,1,1,3,1,3,3,1,1,3,3,1,1,3,3,3,3,1,1,3,
3,4,3,3,1,3,1,2,2,1,1,1,1,1,1,1,4,4,3,1,3,1,3,3,1,1,1,1,2,4,3,3,3,3,4,3,3,2,3,3,3,3,4,3,1,3,1,1,1,1,
1,3,3,3,1,2,1,1,3,1,1,3,1,1,3,3,1,4,1,3,3,3,1,1,3,3,1,3,3,1,3,1,2,2,1,1,1,1,1,1,1,4,4,1,2,2,1,3,3,1,
1,1,1,2,4,3,3,3,3,2,3,3,1,3,3,3,3,1,3,1,1,1,1,1,3,2,3,1,3,3,2,1,1,3,3,3,3,1,3,3,3,1,4,2,3,3,3,1,1,4,
1,4,1,3,3,1,2,3,3,2,1,1,3,3,3,1,2,3,3,3,4,3,3,3,3,1,2,2,1,1,1,1,1,1,1,4,4,3,1,3,4,3,3,1,1,1,1,2,4,3,
3,3,3,2,3,3,2,3,3,3,3,4,3,1,2,1,1,1,1,3,3,1,3,1,2,1,1,3,1,3,3,1,1,3,3,1,1,3,3,3,3,1,1,3,3,4,3,3,1,3,
1,2,2,1,1,1,1,1,1,1,4,4,3,1,3,1,3,3,1,1,1,1,2,4,3,3,3,3,4,3,3,2,3,3,3,3,4,3,1,3,1,1,1,1,1,3,3,3,1,2,
1,1,3,1,1,3,1,1,3,3,1,4,1,3,3,3,1,1,3,3,1,3,3,1,3,1,2,2,1,1,1,1,1,1,1,4,4,1,2,2,1,3,3,1,1,1,1,2,4,3,
3,3,3,2,3,3,1,3,3,3,3,1,3,1,1,1,1,1,3,2,3,1,3,3,2,1,1,3,3,3,3,1,3,3,1,1,4,2,3,3,3,1,1,4,1,4,1,3,3,1,
2,3,3,2,1,1,3,3,3,1,2,3,3,3,4,3,3,3,3,1,2,2,1,1,1,1,1,1,1,4,4,3,1,3,4,3,3,1,1,1,1,2,4,3,3,3,3,2,3,3,
2,3,3,3,3,4,3,1,2,1,1,1,1,3,3,1,3,1,2,1,1,3,1,3,3,1,1,3,3,1,1,3,3,3,3,1,1,3,3,4,3,3,1,3,1,2,2,1,1,1,
1,1,1,1,4,4,3,1,3,1,3,3,1,1,1,1,2,4,3,3,3,3,4,3,3,2,3,3,3,3,4,3,1,3,1,1,1,1,1,3,3,3,1,2,1,1,3,1,1,3,
1,1,3,3,1,4,1,3,3,3,1,1,3,3,1,3,3,1,3,1,2,2,1,1,1,1,1,1,1,4,4,1,2,2,1,3,3,1,1,1,1,2,4,3,3,3,3,2,3,3,
1,3,3,3,3,1,3,1,1,1,1,1,3,2,3,1,3,3,2,1,1,3,3,3,3,1,3,3,3,1,4,2,3,3,3,1,1,4,1,4,1,3,3,1,2,3,3,2,1,1,
3,3,3,1,2,3,3,3,4,3,3,3,3,1,2,2,1,1,1,1,1,1,1,4,4,3,1,3,4,3,3,1,1,1,1,2,4,3,3,3,3,2,3,3,2,3,3,3,3,4,
3,1,2,1,1,1,1,3,3,1,3,1,2,1,1,3,1,3,3,1,1,3,3,1,1,3,3,3,3,1,1,3,3,4,3,3,1,3,1,2,2,1,1,1,1,1,1,1,4,4,
3,1,3,1,3,3,1,1,1,1,2,4,3,3,3,3,4,3,3,2,3,3,3,3,4,3,1,3,1,1,1,1,1,3,3,3,1,2,1,1,3,1,1,3,1,1,3,3,1,4,
1,3,3,3,1,1,3,3,1,3,3,1,3,1,2,2,1,1,1,1,1,1,1,4,4,1,2,2,1,3,3,1,1,1,1,2,4,3,3,3,3,2,3,3,1,3,3,3,3,1,
3,1,1,1,1,1,3,2,3,1,3,3,2,1,1,3,3,3,3,1,3,3,3,1,4,2,3,3,3,1,1,4,1,4,1,3,3,1,2,3,3,2,1,1,3,3,3,1,2,3,
3,3,4,3,3,3,3,1,2,2,1,1,1,1,1,1,1,4,4,3,1,3,4,3,3,1,1,1,1,2,4,3,3,3,3,2,3,3,2,3,3,3,3,4,3,1,2,1,1,1,
1,3,3,1,3,1,2,1,1,3,1,3,3,1,1,3,3,1,1,3,3,3,3,1,1,3,3,4,3,3,1,3,1,2,2,1,1,1,1,1,1,1,4,4,3,1,3,1,3,3,
1,1,1,1,2,4,3,3,3,3,4,3,3,2,3,3,3,3,4,3,1,3,1,1,1,1,1,3,3,3,1,2,1,1,3,1,1,3,1,1,3,3,1,4,1,3,3,3,1,1,
3,3,1,3,3,1,3,1,2,2,1,1,1,1,1,1,1,4,4,1,2,2,1,3,3,1,1,1,1,2,4,3,3,3,3,2,3,3,1,3,3,3,3,1,3,1,1,1,1,1,
3,2,3,1,3,3,2,1,1,3,3,3,3,1,3,3,3,1,4,2,3,3,3,1,1,4,1,4,1,3,3,1,2,3,3,2,1,1,3,3,3,1,2,3,3,3,4,3,3,3,
3,1,2,2,1,1,1,1,1,1,1,4,4,3,1,3,4,3,3,1,1,1,1,2,4,3,3,3,3,2,3,3,2,3,3,3,3,4,3,1,2,1,1,1,1,3,3,1,3,1,
2,1,1,3,1,3,3,1,1,3,3,1,1,3,3,3,3,1,1,3,3,4,3,3,1,3,1,2,2,1,1,1,1,1,1,1,4,4,3,1,3,1,3,3,1,1,1,1,2,4,
3,3,3,3,4,3,3,2,3,3,3,3,4,3,1,3,1,1,1,1,1,3,3,3,1,2,1,1,3,1,1,3,1,1,3,3,1,4,1,3,3,3,1,1,3,3,1,3,3,1,
3,1,2,2,1,1,1,1,1,1,1,4,4,1,2,2,1,3,3,1,1,1,1,2,4,3,3,3,3,2,3,3,1,3,3,3,3,1,3,1,1,1,1,1,3,2,3,1,3,3,
2,1,1,3,3,3,3,1,3,3,3,1,4,2,3,3,3,1,1,4,1,4,1,3,3,1,2,3,3,2,1,1,3,3,3,1,2,3,3,3,4,3,3,3,3,1,2,2,1,1,
1,1,1,1,1,4,4,3,1,3,4,3,3,1,1,1,1,2,4,3,3,3,3,2,3,3,2,3,3,3,3,4,3,1,2,1,1,1,1,3,3,1,3,1,2,1,1,3,1,3,
3,1,1,3,3,1,1,3,3,3,3,1,1,3,3,4,3,3,1,3,1,2,2,1,1,1,1,1,1,1,4,4,3,1,3,1,3,3,1,1,1,1,2,4,3,3,3,3,4,3,
3,2,3,3,3,3,4,3,1,3,1,1,1,1,1,3,3,3,1,2,1,1,3,1,1,3,1,1,3,3,1,4,1,3,3,3,1,1,3,3,1,3,3,1,3,1,2,2,1,1,
1,1,1,1,1,4,4,1,2,2,1,3,3,1,1,1,1,2,4,3,3,3,3,2,3,3,1,3,3,3,3,1,3,1,1,1,1,1,3,2,3,1,3,3,2,1,1,3,3,3,
3,1,3,3,3,1,4,2,3,3,3,1,1,4,1,4,1,3,3,1,2,3,3,2,1,1,3,3,3,1,2,3,3,3,4,3,3,3,3,1,2,2,1,1,1,1,1,1,1,4,
4,3,1,3,1,3,3,1,1,1,1,2,4,3,3,3,3,4,3,3,2,3,3,3,3,4,3,1,3,1,1,1,1,1,3,3,3,1,2,1,1,3,1,1,3,1,1,3,3,1,
4,1,3,3,3,1,1,3,3,1,3,3,1,3,1,2,2,1,1,1,1,1,1,1,4,4,1,2,2,1,3,3,1,1,1,1,2,4,3,3,3,3,2,3,3,1,3,3,3,3,
1,3,1,1,1,1,1,3,2,3,1,3,3,2,1,1,3,3,3,3,1,3,3,3,1,4,2,3,3,3,1,1,4,1,4,1,3,3,1,2,3,3,2,1,1,3,3,3,1,2,
3,3,3,4,3,3,3,3,1,2,2,1,1,1,1,1,1,1,4,4,3,1,3,1,3,3,1,1,1,1,2,4,3,3,3,3,4,3,3,2,3,3,3,3,4,3,1,3,1,1,
1,1,1,3,3,3,1,2,1,1,3,1,1,3,1,1,3,3,1,4,1,3,3,3,1,1,3,3,1,3,3,1,3,1,2,2,1,1,1,1,1,1,1,4,4,1,2,2,1,3,
3,1,1,1,1,2,4,3,3,3,3,2,3,3,1,3,3,3,3,4,3,1,2,1,1,1,1,3,3,1,3,1,2,1,1,3,1,3,3,1,1,3,3,1,1,3,3,3,3,1,
1,3,3,4,3,3,1,3,1,2,2,1,1,1,1,1,1,1,4,4,3,1,3,1,3,3,1,1,1,1,2,4,3,3,3,3,4,3,3,2,3,3,3,3,4,3,1,3,1,1,
1,1,1,3,3,3,1,2,1,1,3,1,1,3,1,1,3,3,1,4,1,3,3,3,1,1,3,3,1,3,3,1,3,1,2,2,1,1,1,1,1,1,1,4,4,1,2,2,1,3,
3,1,1,1,1,2,4,3,3,3,3,2,3,3,1,3,3,3,3,1,3,1,1,1,1,1,3,2,3,1,3,3,2,1,1,3,3,3,3,1,3,3,1,1,4,2,3,3,3,1,
1,4,1,4,1,3,3,1,2,3,3,2,1,1,3,3,3,1,2,3,3,3,4,3,3,3,3,1,2,2,1,1,1,1,1,1,1,4,4,3,1,3,4,3,3,1,1,1,1,2,
4,3,3,3,3,2,3,3,2,3,3,3,3,4,3,1,2,1,1,1,1,3,3,1,3,1,2,1,1,3,1,3,3,1,1,3,3,1,1,3,3,3,3,1,1,3,3,4,3,3,
1,3,1,2,2,1,1,1,1,1,1,1,4,4,3,1,3,1,3,3,1,1,1,1,2,4,3,3,3,3,4,3,3,2,3,3,3,3,4,3,1,3,1,1,1,1,1,3,3,3,
1,2,1,1,3,1,1,3,1,1,3,3,1,4,1,3,3,3,1,1,3,3,1,3,3,1,3,1,2,2,1,1,1,1,1,1,1,4,4,1,2,2,1,3,3,1,1,1,1,2,
4,3,3,3,3,2,3,3,1,3,3,3,3,1,3,1,1,1,1,1,3,2,3,1,3,3,2,1,1,3,3,3,3,1,3,3,3,1,4,2,3,3,3,1,1,4,1,4,1,3,
3,1,2,3,3,2,1,1,3,3,3,1,2,3,3,3,4,3,3,3,3,1,2,2,1,1,1,1,1,1,4,4,1,3,4,3,1,3,3,1,3,1,1,2,4,3,2,3,3,3,
3,4,2,1,1,3,3,2,3,1,2,1,1,1,1,3,3,4,3,1,2,3,1,3,1,1,1,1,1,1,3,1,4,1,3,1,3,3,3,1,4,4,2,3,1,1,4,4,1,1,
1,2,1,2,1,2,3,0)
peptide = box length:1 width:1 height:1  position:[0,0,-.5] wirecolor:[250,250,250]; Converttomesh peptide
for k = 1 to 4500 do(
element = box length:1 width:1 height:1 pos:[0,0,0]; Converttomesh element
attach peptide element; peptide.pivot = [0,0,0]; move peptide [dx[kk[k]],dy[kk[k]],dz[kk[k]]]
rotate peptide angx[kk[k]] [1,0,0]; rotate peptide angy[kk[k]] [0,1,0]; rotate peptide angz[kk[k]] [0,0,1])

https://img-fotki.yandex.ru/get/373339/158289418.4bb/0_18a3fa_79817ce3_XL.png
Оригинал: https://img-fotki.yandex.ru/get/373339/ … 3_orig.png

Развернуто:

https://img-fotki.yandex.ru/get/370744/158289418.4bc/0_18a569_fd9446b9_XL.png
0.25 от оригинала: https://img-fotki.yandex.ru/get/370744/ … 9_orig.png
Оригинал: https://cloud.mail.ru/public/8gC2/mkhM3wWW4

https://img-fotki.yandex.ru/get/9494/158289418.4bc/0_18a589_4694862e_orig.gif

Настройки одного из 5 композиционных углов по одной из трёх составляющих заняла около двух часов:

https://img-fotki.yandex.ru/get/371487/158289418.4bc/0_18a588_ce47e849_orig.gif
Настройка 5 композиционных углов по 3 составляющим может занять около 30 часов. Однако это не имеет смысла, т.к. в реальном белке композиционные и транспозиционные (это ещё столько столько же степеней свободы) на разных участках белка разные. А третий угол Pro - ещё одна степень свободы, которая без учета физико-химических взаимодействий тоже представляет собой неопределенность.

155

Re: Рекорды сверхдлинных спиралей белковых молекул

Рекорды сверхдлинных спиралей белковых молекул

Kushelev пишет:

Формы, механизмы, энергия наномира. Сообщение 92 727

Рекорды сверхдлинных спиралей белковых молекул

Online service PROTEIN PICOTECHNOLOGY

Заказ 2017-11-25_04:

https://www.ncbi.nlm.nih.gov/nuccore/XM … port=fasta

>XM_022674627.1 PREDICTED: Astyanax mexicanus protein FAM133-like (LOC111193520), partial mRNA
GTCCAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAA

Результат:

https://img-fotki.yandex.ru/get/872977/158289418.4a8/0_186f28_9609f17b_XL.png

Развернуто:

https://img-fotki.yandex.ru/get/478910/158289418.4a8/0_186f29_f1769699_XL.png
Оригинал: https://img-fotki.yandex.ru/get/478910/ … 9_orig.png

Нашёлся лизиновый "хвост" длиной 263 аминокислотных остатка Lys. Рекорд однако...

Новая версия Пикотех 2D показывает пи-спирали аналогично альфа-спиралям.

https://img-fotki.yandex.ru/get/478621/158289418.4c5/0_18cd7d_47f32c94_orig.png

156

Re: Рекорды сверхдлинных спиралей белковых молекул

Формы, механизмы, энергия наномира. Сообщение 95 663

Рекорды сверхдлинных спиралей белковых молекул

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-02-05_01:

https://www.ncbi.nlm.nih.gov/nuccore/568179845

>CRL29754
atgccttttgagatgccttttgagatgccttttgagatgccttttgagatgccttttgag
atgccttttgagatgccttttgagatgccttttgagatgccttttgagatgccttttgag
atgccttttgagatgccttttgagatgccttttgagatgccttttgagatgccttttgag
atgccttttgagatgccttttgagatgccttttgagatgccttttgagatgccttttgag
atgccttttgagatgccttttgagatgccttttgagatgccttttgagatgccttttgag
atgccttttgagatgccttttgagatgccttttgagatgccttttgagatgccttttgag
atgccttttgagatgccttttgagatgccttttgagatgccttttgagatgccttttgag
atgccttttgagatgccttttgagatgccttttgagatgccttttgagatgccttttgag
atgccttttgagatgccttttgagatgccttttgagatgccttttgagatgccttttgag
atgccttttgagatgccttttgagatgccttttgagatgccttttgagatgccttttgag
atgccttttgagatgccttttgagatgccttttgagatgccttttgagatgccttttgag
atgcctttccccccctcacacttctttcaaaacattcttctactgcctttgcctattctt
tatccctcctatttcatttatcattctctcactttcttaccttacatcgaaaatgggaag
agactgggtccgtcaaccggaggaaaaatcgacatgggaacagtctcaacttggatggtc
ttccacttttccatccacaattactgggacaatgtcaagcaagaagcacgtctcacccta
tcttatgtccgcttgacggacgaagggattttctactgcatctgtaccatgacacctcac
cagcggacctcgcggttccaggccgacttcgaccaacatggagacatccggacctcacgt
attctattggaccccccaatgattgtttgggctaatggcctaccgtggttccctgtttac
aaagctttttccgtcctctgtggaagttggaatgcggtatcctatctagtcggtcgcaaa
tatcggtcaagtatctccgagttctaccttggtgcagccttagccccgcccgaagcagtg
caggcgagccaagaagattccctcacctcttcatactttcttccttgcatccctttttga

Результат:

https://img-fotki.yandex.ru/get/482931/158289418.4c6/0_18cda0_db7bf68b_XL.png

Развернуто:

https://img-fotki.yandex.ru/get/482931/158289418.4c6/0_18cda1_ef3a7b7c_XL.png
Оригинал: https://img-fotki.yandex.ru/get/482931/ … c_orig.png

157

Re: Рекорды сверхдлинных спиралей белковых молекул

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-14_011: GKSQIGKSQIGKSQIGKSQIGKSQIGKSQIGKSQIGKSQIGKSQIGKSQI

>PGOL01007770.1:c3269-1 Punica granatum strain AG2017 PG007770, whole genome shotgun sequence
atccaaggatgggactcggcctggggaagatctaacgatgggattcggcccaacgaaaga
tcaaaggttgggactcggcccagggggagatctaacgatgggactcagccctacggaaga
tcaaaggttgggactcgtccctgggggagatctaacgatgcgactcggccctacgaaagt
tcaaaggatgggactcggccctgggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactccgccctgtgggagatctaacgatgggactcgaccctacggaaga
tcaaaggttgggactcagcccagggggagatctaacgatgggactcggccctacggaaga
tcaaaggttgggactcggccctgtgggagatctaacgatgcgactcggccctacggaaga
tcaaaggttgggactccgcccagggggagatctaacggtgggactcggccctacggaaga
tcaaaggttgggactcggctctgggggagatctaacgatgagactcggccctacgaaaga
tcaaaggatgggactcggcccagggggagatctaa

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/nDFBwgyC-6zzOA
Развернуть: https://yadi.sk/i/K9jwT9lakQ0zAA
Слушать(MIDI): https://yadi.sk/d/UIhJRsRH669gyw

Программная спираль строится в 40-дольном музыкальном размере.

Структуры белков такого типа могут наглядно продемонстрировать триумф пикотехнологии белков.

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/X2zaTRlKbAPevw

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/AqNvNU1_DMpjKg

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/02o8pb1oj0DUCg

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/YWhzsoqRaw5E3w

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/5cDhg4KlmVkmRQ

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/RbV-Te2qx0hyPw
Полновесная анимация (avi, 63Mb): https://yadi.sk/i/cdixlJKwoI9Eyw

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/tRyTwNarkCi-CA
Полновесная анимация (avi, 27Mb): https://yadi.sk/i/g9qzgoDeH12mMA

Обратите внимание на пары радикалов лизина (Lys):

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/zzGCvdTc9UUHHA

Напомню, как выглядит пикотехнологическая модель ДНК:

http://nanoworld88.narod.ru/data/237_files/0_4e1a8_e8302c5f_M.gif

158

Re: Рекорды сверхдлинных спиралей белковых молекул

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_004: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://www.ncbi.nlm.nih.gov/nuccore/PG … nd-gaps=on

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/Mz6T1d2VoligAA
Развернуть: https://yadi.sk/i/bYyef3FC-vhIcw
Слушать(MIDI): https://yadi.sk/d/ks6qwoYGIihtfA

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_005: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://www.ncbi.nlm.nih.gov/protein/PK … TFVRRBH014

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/yF4whemjrPY5Qw

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/lBJ8kZiyPjYNbQ

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/6HUSYZ3OIdjQow

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/8oTVlq-8dwdJzg

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/YTEU2VFuJYi1LA

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/BpRIO3HupXLu0A

Кушелев: Punica granatum - даже не золотое, а бриллиантовое дно!

В одном геномном файле 6 "монстров белкового мира" подряд!

Нужно будет делать их 3D модели и настраивать по ним интерактивную версию Пикотех 3D. Скорее всего все эти белки работают с ДНК/РНК, а значит должны быть согласованы с ними по многим параметрам.

159

Re: Рекорды сверхдлинных спиралей белковых молекул

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_007: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://www.ncbi.nlm.nih.gov/protein/PK … TFVRRBH014

https://www.ncbi.nlm.nih.gov/nuccore/PG … nd-gaps=on

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/nfmTWpEA3Dy3Aw

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/GQWGN27mYt_2uA

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/ZOGbm_M9Gjv5mQ

Кушелев: Информация к размышлению для тех, кто хочет обриллиантить человечество и, в том числе, себя smile

160

Re: Рекорды сверхдлинных спиралей белковых молекул

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_008: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://www.ncbi.nlm.nih.gov/nuccore/PG … nd-gaps=on

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/d32uiBmHe2dWZQ

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/PjGD_21sqMfgDA

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/GPSyk7lxKYUZ1A

Кушелев: Обриллиантим человечество вместе?