681

Re: Online service PROTEIN PICOTECHNOLOGY

Формы, механизмы, энергия наномира. Сообщение 92 727

Рекорды сверхдлинных спиралей белковых молекул

Online service PROTEIN PICOTECHNOLOGY

Заказ 2017-11-25_04:

https://www.ncbi.nlm.nih.gov/nuccore/XM … port=fasta

>XM_022674627.1 PREDICTED: Astyanax mexicanus protein FAM133-like (LOC111193520), partial mRNA
GTCCAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAA

Результат:

https://img-fotki.yandex.ru/get/872977/158289418.4a8/0_186f28_9609f17b_XL.png

Развернуто:

https://img-fotki.yandex.ru/get/478910/158289418.4a8/0_186f29_f1769699_XL.png
Оригинал: https://img-fotki.yandex.ru/get/478910/ … 9_orig.png

Нашёлся лизиновый "хвост" длиной 263 аминокислотных остатка Lys. Рекорд однако...

682

Re: Online service PROTEIN PICOTECHNOLOGY

Заказ 2017-11-25_05:

https://www.ncbi.nlm.nih.gov/nuccore/700454480

>KGO44433
atggacaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagtga

Результат:

https://img-fotki.yandex.ru/get/878955/158289418.4a8/0_186f2a_83132c7f_XL.png

Развернуто:

https://img-fotki.yandex.ru/get/914553/158289418.4a9/0_186f2b_d3b23609_XL.png
Оригинал: https://img-fotki.yandex.ru/get/914553/ … 9_orig.png

Мы видим, что лизиновые "хвосты" бывают не только пи-спиральными, но и альфа-спиральными...
Аутоантигомология...

683

Re: Online service PROTEIN PICOTECHNOLOGY

Заказ 2017-11-25_06:

https://www.ncbi.nlm.nih.gov/nuccore/632911273

>KDB11191
atgaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaag
aagaagaagaagaagaagaagaagaagaagaagaagaagaagacgaagaattggttggtt
acgggtcaaatcgcggaaatggaatttaaaaaagcaaaggaggaagtgagacttgctgcc
aaatcaaactgcatcaagtcatga

Результат:

https://img-fotki.yandex.ru/get/480022/158289418.4a9/0_186f2c_5a5e1c4c_XL.png

Развернуто:

https://img-fotki.yandex.ru/get/892397/158289418.4a9/0_186f2d_7db06094_XL.png
Оригинал: https://img-fotki.yandex.ru/get/892397/ … 4_orig.png

Это уже не "хвост", а "нос", но тоже представленный прямой альфа-спиралью полилизина...

684

Re: Online service PROTEIN PICOTECHNOLOGY

Заказ 2017-11-25_07:

https://www.ncbi.nlm.nih.gov/nuccore/632911273

>KDB11201
atggcggagacgtggaggctgtgcaagaacaaaaacaagaagcacaagaagcacaagcag
cacaagaagcacaaggacaagaagcacaaggacaagaagcacaagaagcacaagcagcac
aagaagtacaagaagcacaagcacaagaagcacaagcacaagaagcacaagcacaagaag
cacaagcagcacaagaagcacaagcacaagaagcacaagcacaagaggcacaagaagcac
aagcagcacaagcagcacaagcacaagaagcacaagcacaagcagcacaaagcggcaact
cacaacagacaccaacgccgcccgggcgcgtatggcaaatcagtcgcttgtcccgctcgc
atgcgtgcgtttataggtgggcgccgcatccagcgatga

Результат:

https://img-fotki.yandex.ru/get/875526/158289418.4a9/0_186f2f_696ee037_XL.png

Развернуто:

https://img-fotki.yandex.ru/get/893240/158289418.4a9/0_186f30_2d2820b0_XL.png
Оригинал: https://img-fotki.yandex.ru/get/893240/ … 0_orig.png

685

Re: Online service PROTEIN PICOTECHNOLOGY

Формы, механизмы, энергия наномира. Сообщение 92 821

Пикотехнология белков, ДНК, РНК - 3

Рекорды сверхдлинных спиралей белковых молекул

Online service PROTEIN PICOTECHNOLOGY

http://nanoworld.org.ru/topic/1656/page/13/

Kushelev пишет:

Заказ 2017-11-19_17:

https://www.ncbi.nlm.nih.gov/nuccore/1129206831

>OLQ08878
atgcgacaagcagccccagcgggtcctccgagaggtgagctgaacggcctgtccaggtcc
gatccacgagcgctaatggctgcagcagcagcgaaggtggcccagacgtctgtggttccg
gagagattagttgagagcagctcctcaagcagcaagccggcggctccctcagccggacag
tgtgcgtgcgcgtgcgtgtgcgtgtgcgtgtgcgtgtgcgtgtgcgtgcgcgtgtgcgcg
tgtgtgtgtgtgtgcgcgtgtngtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggt
gtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggt
gtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggt
gtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggt
gtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggt
gtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggt
gtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggt
gtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggt
gtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggt
gtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggt
gtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggt
gtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggt
gtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggt
gtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggt
gtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggt
gtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtgggtgtctgt
gtgtgtgcatgttacatagcattcatgacaacaagaccggtcagtcttgtcatcaccatc
atcattgccaccatcttcaccatcgtcctcgtaggtcgtaggtga

Результат:

https://img-fotki.yandex.ru/get/872132/158289418.4a5/0_186966_1f6e83a7_XL.png

Развернуто:

https://img-fotki.yandex.ru/get/877150/158289418.4a5/0_186967_f33d2f73_XL.png
Оригинал: https://img-fotki.yandex.ru/get/877150/ … 3_orig.png

Online service PROTEIN PICOTECHNOLOGY

Заказ 2017-11-26_01:

P43537

http://www.uniprot.org/uniprot/P43537

https://www.ebi.ac.uk/ena/data/view/BAA … play=fasta

>ENA|BAA09174|BAA09174.1 Saccharomyces cerevisiae (baker's yeast) hypothetical protein
ATGGAATCTATTATCCTCAGCATTGCCATCTTTATTGGCGTCCTCCTTGGCACTAGCGTT
GGTGCTGGCAGTGGTAGTAGCATTAGTCCTGACGTTGATGCTGGCAGTGGTAGTCGCACT
AGTCCTGACGTTGATGCTGGCAGTGGTAGTCGCATTAGTGCTGGAGTTGGTACTTTCAGT
GGTAGTAGCACTAGTCCTGACGTTGATGCTGGCAGTGGTAGTAGCACTAGTCCTGACGTT
GGTGCTGGCAGTGGTAGTAGCATTAGTGCTGGAGTTGGTAGTCGCATTGGTACTGGCATT
GGTAGTCGCATTGGTACTGGCATTGGTACTGGCATTGGTAGTCGCATTAGTACTAGCATT
GGTAGTCGCATTAGTCCTGACGTTGGTACTAGCAGTGGTAATCGCATTAGTACTGGCGTT
AGTACTGGCATTAGCACTACCATGAATGCACGTGTCGCTGTCCTCATCACTGCTGCAATA
CTTTCTGCACCTGTCACTGCTATTGCTCTCCTGGAAGCTAGACGGTAA

Результат:

https://img-fotki.yandex.ru/get/876523/158289418.4a9/0_186f8d_7bef5217_XL.png

Развернуто:

https://img-fotki.yandex.ru/get/876523/158289418.4a9/0_186f8e_c7df3c71_XL.png
Оригинал: https://img-fotki.yandex.ru/get/876523/ … 1_orig.png

Кушелев: Белок с протяженной программной 35-спиралью в базе данных ассоциирован с другим белком из базы UNIPROT с протяженным участком программной 3335-спирали.

https://img-fotki.yandex.ru/get/478477/158289418.4a9/0_186f90_173214ef_orig.png
Так изображена структура этого белка в базе данных UNIPROT: https://www.proteinmodelportal.org/?pid … ;zid=async

Мы видим, что пикотехнологическая модель не противоречит официальной модели. Просто она более детальная smile

686

Re: Online service PROTEIN PICOTECHNOLOGY

Online service PROTEIN PICOTECHNOLOGY

Заказ 2017-11-26_02:

http://www.uniprot.org/uniprot/A6ZKI8

https://www.ebi.ac.uk/ena/data/view/EDN … play=fasta

>ENA|EDN64918|EDN64918.1 Saccharomyces cerevisiae YJM789 partial conserved protein
CTAGCGTTGGTACTTTCAGTGGTAGTGGCATTAGTGCTGGAGTTGGTACCTTCAGTGGTA
GTAGCATTAGTGCTGGAGTTGGTACTTTCAGTGGTAGTAGCATTAGTGCTGGAGTTGGTA
CTTTCAGTGGTAGTCGCACTAGTCCTGACGTTGATGCTGGCAGTGGTAGTAGCATTAGTG
CTGGAGTTGGTACTTTCAGTGGTAGTAGCATTAGTGTTGGAGTTGGTACTTTCAGTGGTA
GTCGCACTAGTCCTGACGTTGATGCTGGCAGTGGTAGTCGCACTAGTCCTGACGTTGATG
CTGGCAGTGGTAGTAGCATTAGTGCTGGAGTTGGTAGTCGCATTGGTACTGGCATTAGCA
CTACCATGAATGCACGTGTCGCTGTCCTCATCACTGCTGCAATACTTTCTGCACCTGTCA
CTGCTATTGCTCTCCTGGAAGCTAGACGGTAA

Результат:

https://img-fotki.yandex.ru/get/9224/158289418.4a9/0_186f91_233e97db_XL.png
Аминокислотная последовательность не совпадает с контрольной

https://img-fotki.yandex.ru/get/483372/158289418.4a9/0_186f94_e120dd1d_XL.png
При комплементарном преобразовании та же ерунда...

Вернёмся от комплементарной последовательности к прямой и сдвинем рамку считывания на 1 символ.

https://img-fotki.yandex.ru/get/896238/158289418.4a9/0_186f96_655aee86_XL.png

Опять не совпадает. Сдвигаем рамку считывания ещё на один символ...

https://img-fotki.yandex.ru/get/897139/158289418.4a9/0_186f98_3c0803aa_XL.png

Совсем другое дело!

Развернуто:

https://img-fotki.yandex.ru/get/897139/158289418.4a9/0_186f99_4c0e8cfc_XL.png
Оригинал: https://img-fotki.yandex.ru/get/897139/ … c_orig.png

Мы снова видим участки программной 3335-спирали.

687

Re: Online service PROTEIN PICOTECHNOLOGY

Заказ 2017-11-26_03:

https://www.ebi.ac.uk/ena/data/view/EDN … play=fasta

>ENA|EDN61323|EDN61323.1 Saccharomyces cerevisiae YJM789 conserved protein
ATGGAATCTATTATCCTCAGCATTGCCATCTTTATTGGCGTCCTCCTTGGCACTAGCGTT
GGTACTTTCAGTGGTAGTGGCATTAGTGCTGGAGTTGGTGCTAGCAGTGGTAGTAGCACT
AGTGTTGGAGTCGGTACTTTCGGTGGTAGTAGCACTAGTGTTGGAGTCGGTACTTTCGGT
GGTAGTCGCACTAGTGTTGGAGTCGGTACTTTCGGTGGTAGTCGCACTAGTCCTGACGTT
GATGCTGGCAGTGGTAGTAGCACTAGTCCTGACGTTGGTGCTGGCAGTGGTAGTAGCATT
AGTGCTGGAGTTGGTAGTCGCATTGGTACTGGCATTAGCACTACCATGAATGCACGTGTC
GCTGTCCTCATCACTGCTGCAATACTTTCTGCACCTGTCACTGCTATTGCTCTCCTGGAA
GCTAGACGGTAA

Результат:

https://img-fotki.yandex.ru/get/900241/158289418.4a9/0_186f9a_3b7ae84f_XL.png

Развернуто:

https://img-fotki.yandex.ru/get/897139/158289418.4a9/0_186f9b_7daca50_XL.png
Оригинал: https://img-fotki.yandex.ru/get/897139/ … 0_orig.png

688

Re: Online service PROTEIN PICOTECHNOLOGY

Заказ 2017-11-26_04:

https://www.ebi.ac.uk/ena/data/view/CBK … play=fasta

>ENA|CBK33657|CBK33657.1 Saccharomyces cerevisiae EC1118 EC1118_1F29_0061p
ATGGAATCTATTATCCTCAGCATTGCCATCTTTATTGGCGTCCTCCTTGGCACTAGCGTT
GGTACTTTCAGTGGTAGTGGCATTAGTGCTGGAGTTGGTGCTAGCAGTGGTAGTGGCATT
AGTGCTGGAGTTGGTGCTAGCAGTGGTAGTAGCACTAGTGTTGGAGTCGGTACTTTCGGT
GGTAGTAGCATTAGTGCTGGAGTTGGTACTTTCAGTGGTAGTCGCACTAGTGTTGGAGTT
GGTACTTTCAGTGGTAGTCGCACTAGTCCTGACGTTGGTGCTGGCAGTGGTAGTAGCATT
AGTGCTGGAGTTGGTAGTCGCAGTGGTAGTAGCATTAGTGCTGGAGTTGGTAGTCGCATT
GGTACTGGCATTAGCACTACCATGAATGCACGTGTCGCTGTCCTCATCACTGCTGCAATA
CTTTCTGCACCTGTCACTGCTATTGCTCTCCTGGAAGCTAGACGGTAA

Результат:

https://img-fotki.yandex.ru/get/373339/158289418.4a9/0_186f9c_db456134_XL.png

Развернуто:

https://img-fotki.yandex.ru/get/509063/158289418.4a9/0_186f9d_e8b535eb_XL.png
Оригинал: https://img-fotki.yandex.ru/get/509063/ … b_orig.png

689

Re: Online service PROTEIN PICOTECHNOLOGY

Формы, механизмы, энергия наномира. Сообщение 92 844

Online service PROTEIN PICOTECHNOLOGY

Заказ 2017-11-26_05:

https://www.ncbi.nlm.nih.gov/nuccore/NC … mask=65536

>XP_022527087
atggggaagagtccgatctgcttcagaccaatgaaaacacgacacagtgtgaggttggcg
gatggtggcagtcgctgtgctgggagagtggaggttcttcatggagagagctgggtcaca
gtgtgtgatgctgactttgactcagaggagcttcagtgtagaggaaacgaatctcagatt
cacttctgtccaaaatcatcttcactcaaacacaactgctcccatgataatgatgtggga
ctggtgtgtgctgacagtgtgaggttggtggatggtggccatcgctgtgctgggagagtg
gaggttttttatagaggacagtggggatcagtgtgtggtaataactgggatatgagagat
gctgcagtggtgacagtgtgtgattctgactttaaccagcagggtgcagaggttgtgtgt
cgagagctgggctgtggttctcctgtggagattctgggagcagctgcttttggtagaggg
gagggtccggtgtggtcagaggtgcttcagtgtagaggaaacgaatctcagattcacttc
tgtccaaaatcatcttcactcaaacacaactgctcccatgataatgatgtgggactggtg
tgtgcagacagtgtgaggttggcggatggtggcagtcgctgtgctgggagagtggaggtt
cttcatggagagagctgggtcacagtgtgtgatgctgactttaaccagcaggatgcagag
gttgtgtgtcgagagctgggctgtggttctcctgtggaggttctgggagcagctgctttt
ggtagagcagagggtcagatgtggtcagaggagcttcagtgtagaggaaacgaatctcag
attcacttctgtccaaaatcatcttcactcaaacacaactgctcccatgataatgatgtg
ggactggcatgttctggtcacactcaggctcggctgatgaacggctcagattcctgttct
ggtcgagtggagctccagtacctcagtgagtggggtacagtgtgtgatgtaagctgggat
atgagagctgccagtgtcctctgtgctcagctgaagtgtgggagttctgtggctgtgttg
gggtcagactggtttggggaggggagtggccggatctgggctgatgtgtttgattgtcag
ggaaacgaaacacacctgttaaaatgtcccatttcatcatggagtcgaactgcatgctct
catgaacagtatgctggagttatctgtagtggttcttctctggcgtctcatgagggagga
gtgcggttgtctggagggatggagtgtgagggggaggtggaggtgttcttcaggcaggac
tggaggagagttctgctggactcctggagtgagtctgaggcctctgtggtctgcagacag
ctgcagtgtggagtcgccctcagtgctccagtaccagtaccagcccggtttggatctgga
actggacccatttggctgaatgaggtggagtgtgagggggaggtggaggtgttcttcagg
caggactggaggagagttctgctggactcctggagtgagtctgaggcctctgtggtctgc
agacagctgcagtgtggagtcgccctcagtgctccagtaccagtaccagcccggtttgga
tctggaactggacccatttggctgaatgaggtggagtgtgagggggaggtggaggtgttc
ttcaggcaggactggaggagagttctgctggactcctggagtgagtctgaggcctctgtg
gtctgcagacagctgcagtgtggagtcgccctcagtgctccagtaccagtaccagcccgg
tttggatctggaactggacccatttggctgaatgaggtggagtgtgagggggaggtggag
gtgttcttcaggcaggactggaggagagttctgctggactcctggagtgagtctgaggcc
tctgtggtctgcagacagctgcagtgtggagtcgccctcagtgctccagtaccagtacca
gcccggtttggatctggaactggacccatttggctgaatgaggtggagtgtgagggggag
gtggaggtgttcttcaggcaggactggaggagagttctgctggactcctggagtgagtct
gaggcctctgtggtctgcagacagctgcagtgtggagtcgccctcagtgctccagtacca
gtaccagcccggtttggatctggaactggacccatttggctgaatgaggtggagtgtgag
ggggaggtggaggtgttcttcaggcaggactggaggagagttctgctggactcctggagt
gagtctgaggcctctgtggtctgcagacagctgcagtgtggagtcgccctcagtgctcca
gtaccagtaccagcccggtttggatctggaactggacccatttggctgaatgaggtggag
tgtgagggggaggtggaggtgttcttcaggcaggactggaggagagttctgctggactcc
tggagtgagtctgaggcctctgtggtctgcagacagctgcagtgtggagtcgccctcagt
gctccagtaccagtaccagcccggtttggatctggaactggacccatttggctgaatgag
gtggagtgtgagggggaggtggaggtgttcttcaggcaggactggaggagagttctgctg
gactcctggagtgagtctgaggcctctgtggtctgcagacagctgcagtgtggagtcgcc
ctcagtgctccagtaccagtaccagcccggtttggatctggaactggacccatttggctg
aatgaggtggagtgtgagggggaggtggaggtgttcttcaggcaggactggaggagagtt
ctgctggactcctggagtgagtctgaggcctctgtggtctgcagacagctgcagtgtgga
gtcgccctcagtgctccagtaccagtaccagcccggtttggatctggaactggacccatt
tggctgaatgaggtggagtgtgaggggaacgaggcgtctctgtggaactgcagatatcag
ctgtgtggagaggatgaatgtggacacaaggatgatgtaggagtcgtgtgctcagagtat
aaagagatcagactgactgagggctgtgaggggaatctggaggtgtactataatggaacc
tgggggaatgtgtgtgtaaatgggatgactgatgaaacggcaaaattgatctgtcgagag
ctgaactgtggaagaactggcagtgagtcttggtctaaagcaagagtggaatcagctcct
aactggctggataatgtaaaatgtaggaaacatgactccactctgtggcactgtccatct
tcttcctggggggagaacaggtgtgataatcgcaatgaggttgcttgcattacctgctca
gagaatggaaatacactagatttgacaaattggctgtgtgattcatctcctcatgagaga
ccgtgctcaatagagcacattcctctgaggctgaggggaggagtaggaagctgttctgga
tggctgcaggtgtatcataataaaacatgggggtctgtatgtggtgacctctgggacatc
agggatgctcaggtgatctgcaggcagctgggttgtgggccggcgctgagtgctaataga
agagctgctgatggttctggtggaggaactatctggatgaacagagtgaagtgtagaggg
aatgagattcacctgtgggactgtcctcattccctgaagaaccacactgactgctcccac
agtgctggagtcacttgtggaggcttcctgtatcatactttgcctttaaataataaaaga
ggacagatgggacattttgtcttgcaaggtcagggaccacttttctccattgtaaacagg
cttgatagcaacttcgattctcaaccacagacaagaagaatcatacttccacaaactcct
ccaccagctgttccctccatctatccagtgtctctcctggttctgggatatgtgctcttc
ctggccttagtgcttctggttgtgctgttttatcagaacagagtgctcaggagagtgatc
tctaagaggaggaagacttcagctgagcctgtctatgaggagattgacaccaggctcatc
cctaaaagaattactgtctcaactgaaagtaagagtaaaatgttttttttttctctcaaa
gcagaaatgtctggtctttacagaaataatgtagcagttaatcaaatacttgtcagataa

Результат:

https://img-fotki.yandex.ru/get/369087/158289418.4a9/0_186fbb_246086a_XL.png

Развернуто:

https://img-fotki.yandex.ru/get/894414/158289418.4a9/0_186fbc_aff4fc61_XL.png
Оригинал: https://img-fotki.yandex.ru/get/894414/ … 1_orig.png

Фрагмент:

https://img-fotki.yandex.ru/get/878955/158289418.4a9/0_186fbd_fd60660d_XL.png
Оригинал: https://img-fotki.yandex.ru/get/878955/ … d_orig.png

Один период программной спирали:

https://img-fotki.yandex.ru/get/9326/158289418.4a9/0_186fbe_e8900a95_orig.png

Последовательность n(PVPVPARFGSGTGPIWLNEVECEGEVEVFFRQDWRRVLLDSWSESEASVVCRQLQCGVALSA) образует фрактальную 22222553232325355355531414141111111334411135355355535553255533-спираль. 62 аминокислотных остатка в периоде. Периодически повторяющиеся 62 ноты звучат любопытно. Особенно там, где повторяются одинаковые ноты по три раза.

690

Re: Online service PROTEIN PICOTECHNOLOGY

Формы, механизмы, энергия наномира. Сообщение 92 838

Рекорды сверхдлинных спиралей белковых молекул

Программная аллотропия белков опровергает гипотезу фолдинга

Online service PROTEIN PICOTECHNOLOGY

https://img-fotki.yandex.ru/get/879536/158289418.4a9/0_186fc0_a6332fad_orig.png