581

Re: Пикотехнология белков, ДНК, РНК - 2

https://www.ncbi.nlm.nih.gov/protein/24 … C0A790J015

uncharacterized protein KIAA0040 [Homo sapiens]
NCBI Reference Sequence: NP_055471.2
Identical Proteins FASTA Graphics
Go to:
LOCUS       NP_055471                 99 aa            linear   PRI 02-FEB-2016
DEFINITION  uncharacterized protein KIAA0040 [Homo sapiens].
ACCESSION   NP_055471 XP_001720851 XP_001726267 XP_001726488
VERSION     NP_055471.2
DBSOURCE    REFSEQ: accession NM_014656.2
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (residues 1 to 99)
  AUTHORS   Rolland T, Tasan M, Charloteaux B, Pevzner SJ, Zhong Q, Sahni N, Yi
            S, Lemmens I, Fontanillo C, Mosca R, Kamburov A, Ghiassian SD, Yang
            X, Ghamsari L, Balcha D, Begg BE, Braun P, Brehme M, Broly MP,
            Carvunis AR, Convery-Zupan D, Corominas R, Coulombe-Huntington J,
            Dann E, Dreze M, Dricot A, Fan C, Franzosa E, Gebreab F, Gutierrez
            BJ, Hardy MF, Jin M, Kang S, Kiros R, Lin GN, Luck K, MacWilliams
            A, Menche J, Murray RR, Palagi A, Poulin MM, Rambout X, Rasla J,
            Reichert P, Romero V, Ruyssinck E, Sahalie JM, Scholz A, Shah AA,
            Sharma A, Shen Y, Spirohn K, Tam S, Tejeda AO, Trigg SA, Twizere
            JC, Vega K, Walsh J, Cusick ME, Xia Y, Barabasi AL, Iakoucheva LM,
            Aloy P, De Las Rivas J, Tavernier J, Calderwood MA, Hill DE, Hao T,
            Roth FP and Vidal M.
  TITLE     A proteome-scale map of the human interactome network
  JOURNAL   Cell 159 (5), 1212-1226 (2014)
   PUBMED   25416956
REFERENCE   2  (residues 1 to 99)
  AUTHORS   Hill SY, Jones BL, Zezza N and Stiffler S.
  TITLE     Family-based association analysis of alcohol dependence implicates
            KIAA0040 on Chromosome 1q in multiplex alcohol dependence families
  JOURNAL   Open J Genet 3 (4), 243-252 (2013)
   PUBMED   24829844
REFERENCE   3  (residues 1 to 99)
  AUTHORS   Zuo L, Gelernter J, Zhang CK, Zhao H, Lu L, Kranzler HR, Malison
            RT, Li CS, Wang F, Zhang XY, Deng HW, Krystal JH, Zhang F and Luo
            X.
  TITLE     Genome-wide association study of alcohol dependence implicates
            KIAA0040 on chromosome 1q
  JOURNAL   Neuropsychopharmacology 37 (2), 557-566 (2012)
   PUBMED   21956439
  REMARK    GeneRIF: conclude that KIAA0040 might harbor a causal variant for
            AD and thus might directly contribute to risk for this disorder.
            Erratum:[Neuropsychopharmacology. 2012 Jan;37(2):581-2]
REFERENCE   4  (residues 1 to 99)
  AUTHORS   Wang KS, Liu X, Zhang Q, Pan Y, Aragam N and Zeng M.
  TITLE     A meta-analysis of two genome-wide association studies identifies 3
            new loci for alcohol dependence
  JOURNAL   J Psychiatr Res 45 (11), 1419-1425 (2011)
   PUBMED   21703634
  REMARK    GeneRIF: Several flanking SNPs of the top hits in the meta-analysis
            demonstrated borderline associations with alcohol dependence in the
            family sample for KIAA0040, NRD1 and THSD7B, respectively.
REFERENCE   5  (residues 1 to 99)
  AUTHORS   Peng W, Wang HY, Miyahara Y, Peng G and Wang RF.
  TITLE     Tumor-associated galectin-3 modulates the function of
            tumor-reactive T cells
  JOURNAL   Cancer Res. 68 (17), 7228-7236 (2008)
   PUBMED   18757439
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            DB232064.1 and AL049799.1.
            On or before Jul 8, 2009 this sequence version replaced
            gi:169162614, gi:169162382, gi:169161898, gi:7657259.
           
            Transcript Variant: This variant (2) represents use of an alternate
            promoter and 5' UTR, compared to variant 1. All six variants encode
            the same protein.
           
            ##Evidence-Data-START##
            Transcript exon combination :: AL049799.1, BC032361.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           SAMEA1965299, SAMEA1966682
                                           [ECO:0000350]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..99
                     /organism="Homo sapiens"
                     /db_xref="taxon:9606"
                     /chromosome="1"
                     /map="1q25.1"
     Protein         1..99
                     /product="uncharacterized protein KIAA0040"
                     /calculated_mol_wt=11304
     CDS             1..99
                     /gene="KIAA0040"
                     /coded_by="NM_014656.2:558..857"
                     /db_xref="GeneID:9674"
                     /db_xref="HGNC:HGNC:28950"
                     /db_xref="MIM:616696"
ORIGIN     
        1 merisaffss iwdtiltkhq egiynticlg vllglpllvi itllficchc cwsppgkrgq
       61 qpeknkkkkk kkkkkdeedl wisaqpkllq mekrpslpv
//

https://www.ncbi.nlm.nih.gov/nuccore/242332495

Homo sapiens KIAA0040 (KIAA0040), transcript variant 2, mRNA
NCBI Reference Sequence: NM_014656.2
FASTA Graphics
Go to:
LOCUS       NM_014656               4584 bp    mRNA    linear   PRI 02-FEB-2016
DEFINITION  Homo sapiens KIAA0040 (KIAA0040), transcript variant 2, mRNA.
ACCESSION   NM_014656 NR_015350 XM_001720799 XM_001726215 XM_001726436
VERSION     NM_014656.2
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 4584)
  AUTHORS   Rolland T, Tasan M, Charloteaux B, Pevzner SJ, Zhong Q, Sahni N, Yi
            S, Lemmens I, Fontanillo C, Mosca R, Kamburov A, Ghiassian SD, Yang
            X, Ghamsari L, Balcha D, Begg BE, Braun P, Brehme M, Broly MP,
            Carvunis AR, Convery-Zupan D, Corominas R, Coulombe-Huntington J,
            Dann E, Dreze M, Dricot A, Fan C, Franzosa E, Gebreab F, Gutierrez
            BJ, Hardy MF, Jin M, Kang S, Kiros R, Lin GN, Luck K, MacWilliams
            A, Menche J, Murray RR, Palagi A, Poulin MM, Rambout X, Rasla J,
            Reichert P, Romero V, Ruyssinck E, Sahalie JM, Scholz A, Shah AA,
            Sharma A, Shen Y, Spirohn K, Tam S, Tejeda AO, Trigg SA, Twizere
            JC, Vega K, Walsh J, Cusick ME, Xia Y, Barabasi AL, Iakoucheva LM,
            Aloy P, De Las Rivas J, Tavernier J, Calderwood MA, Hill DE, Hao T,
            Roth FP and Vidal M.
  TITLE     A proteome-scale map of the human interactome network
  JOURNAL   Cell 159 (5), 1212-1226 (2014)
   PUBMED   25416956
REFERENCE   2  (bases 1 to 4584)
  AUTHORS   Hill SY, Jones BL, Zezza N and Stiffler S.
  TITLE     Family-based association analysis of alcohol dependence implicates
            KIAA0040 on Chromosome 1q in multiplex alcohol dependence families
  JOURNAL   Open J Genet 3 (4), 243-252 (2013)
   PUBMED   24829844
REFERENCE   3  (bases 1 to 4584)
  AUTHORS   Zuo L, Gelernter J, Zhang CK, Zhao H, Lu L, Kranzler HR, Malison
            RT, Li CS, Wang F, Zhang XY, Deng HW, Krystal JH, Zhang F and Luo
            X.
  TITLE     Genome-wide association study of alcohol dependence implicates
            KIAA0040 on chromosome 1q
  JOURNAL   Neuropsychopharmacology 37 (2), 557-566 (2012)
   PUBMED   21956439
  REMARK    GeneRIF: conclude that KIAA0040 might harbor a causal variant for
            AD and thus might directly contribute to risk for this disorder.
            Erratum:[Neuropsychopharmacology. 2012 Jan;37(2):581-2]
REFERENCE   4  (bases 1 to 4584)
  AUTHORS   Wang KS, Liu X, Zhang Q, Pan Y, Aragam N and Zeng M.
  TITLE     A meta-analysis of two genome-wide association studies identifies 3
            new loci for alcohol dependence
  JOURNAL   J Psychiatr Res 45 (11), 1419-1425 (2011)
   PUBMED   21703634
  REMARK    GeneRIF: Several flanking SNPs of the top hits in the meta-analysis
            demonstrated borderline associations with alcohol dependence in the
            family sample for KIAA0040, NRD1 and THSD7B, respectively.
REFERENCE   5  (bases 1 to 4584)
  AUTHORS   Peng W, Wang HY, Miyahara Y, Peng G and Wang RF.
  TITLE     Tumor-associated galectin-3 modulates the function of
            tumor-reactive T cells
  JOURNAL   Cancer Res. 68 (17), 7228-7236 (2008)
   PUBMED   18757439
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            DB232064.1 and AL049799.1.
            On or before Jul 8, 2009 this sequence version replaced
            gi:169162613, gi:169162381, gi:169161897, gi:205277472, gi:7657258.
           
            Transcript Variant: This variant (2) represents use of an alternate
            promoter and 5' UTR, compared to variant 1. All six variants encode
            the same protein.
           
            ##Evidence-Data-START##
            Transcript exon combination :: AL049799.1, BC032361.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           SAMEA1965299, SAMEA1966682
                                           [ECO:0000350]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-20                DB232064.1         1-20
            21-4584             AL049799.1         1-4564
FEATURES             Location/Qualifiers
     source          1..4584
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="1"
                     /map="1q25.1"
     gene            1..4584
                     /gene="KIAA0040"
                     /note="KIAA0040"
                     /db_xref="GeneID:9674"
                     /db_xref="HGNC:HGNC:28950"
                     /db_xref="MIM:616696"
     exon            1..174
                     /gene="KIAA0040"
                     /inference="alignment:Splign:2.0.8"
     exon            175..248
                     /gene="KIAA0040"
                     /inference="alignment:Splign:2.0.8"
     exon            249..424
                     /gene="KIAA0040"
                     /inference="alignment:Splign:2.0.8"
     exon            425..4584
                     /gene="KIAA0040"
                     /inference="alignment:Splign:2.0.8"
     misc_feature    546..548
                     /gene="KIAA0040"
                     /note="upstream in-frame stop codon"
     CDS             558..857
                     /gene="KIAA0040"
                     /codon_start=1
                     /product="uncharacterized protein KIAA0040"
                     /protein_id="NP_055471.2"
                     /db_xref="GeneID:9674"
                     /db_xref="HGNC:HGNC:28950"
                     /db_xref="MIM:616696"
                     /translation="MERISAFFSSIWDTILTKHQEGIYNTICLGVLLGLPLLVIITLL
                     FICCHCCWSPPGKRGQQPEKNKKKKKKKKKKDEEDLWISAQPKLLQMEKRPSLPV"
     STS             2661..3006
                     /gene="KIAA0040"
                     /standard_name="D1S2394"
                     /db_xref="UniSTS:56335"
     STS             3822..4000
                     /gene="KIAA0040"
                     /standard_name="RH25277"
                     /db_xref="UniSTS:88162"
     STS             4246..4407
                     /gene="KIAA0040"
                     /standard_name="SHGC-75890"
                     /db_xref="UniSTS:8809"
ORIGIN     
        1 tcccacgacc ttggccggcg ccggggccct acacgccaga cctggctcgg ggtgggagtg
       61 cagaggcaac caaaaaggaa cccacacctc cctccagggc ccggggcgct gtcagacggg
      121 gcagcaacca ggagattccc tgggcctgca ggaagccctt ccgcggaccg aaagattgtt
      181 ccccattttg gagatgaaga aactgagact caaagcagct gagtgacctt cccaaggaca
      241 cacactgaac tgggcggtga tcaggatctg aatgcacagg gcgggtgttc agcgattgtt
      301 tactacgttg aacgtgacct ccaggaaagc agttctggcc gagatcccct gacaacgcaa
      361 agcaagaagt aacgtggaag gaggctcccc aagctggctg gccattttgc tgctgtgtgt
      421 ggaggtgctg ccagtggcat gcccaaaccc aaagctggaa gaggaataaa ttacaagtgg
      481 tcaaggttgc atccttttga gcccaggacc tgcttgtaag ccgagagggt tctctggccc
      541 taatctagcc aagcaccatg gagagaatca gtgccttctt cagctctatc tgggacacca
      601 tcttgaccaa acaccaagaa ggcatctaca acaccatctg cctgggagtc ctcctgggcc
      661 tgccactctt ggtgatcatc acactcctct tcatctgttg ccattgctgc tggagcccac
      721 caggcaagag gggccagcag ccagagaaga acaagaagaa gaagaagaag aagaagaaga
      781 aggatgaaga agacctctgg atctctgctc aacccaagct tctccagatg gagaagagac
      841 catcactgcc tgtttagtta ggcaggaagc agaggtgttt cctttctggg gctaagcctc
      901 cttctgacca cacacagaca tttcaggaac ccctgaaata atgcactatg tccatgtcca
      961 cagagtaact actcaaccaa ggaacaaacc tcagactaag tgtcccagtg gagggcagtc
     1021 ccagggacca cgtggacaat tcttggatac tgtcttggca gctatgtgtc caatagcaat
     1081 gctccttact gcagacccag gcatgcctcc cacctgtctc tggcataccc cacatgcaaa
     1141 gcacaaagaa catttatcca tacatctcaa tatggttccc aagtgtgtgc acatgcacgt
     1201 aacacacaca cacacaaatt caggtagcag gtacgtgggc aagtatattc tgctcatcaa
     1261 atggtcattg gctatgtact ttgtgcaggg aagtacatta tctacagtca caaaaatgtc
     1321 tcatgggaaa gccttgccag attcagacac atatatacaa tttcctaacc agcaaggccc
     1381 ccatacacca tctattccat aaaccactca ggttacagat gcatgctttc ctatttctaa
     1441 ctctacacat aaacttttac tggaagtact cataattgga cattccagca acctgctaca
     1501 gtccccaccc ttgtgtgtct tgatacagac acaccaagtt tctgtgcctc tgacccctca
     1561 cctgtgccaa gatgtttaaa gtgtgatggt tcaaaattca ttgaaagctc ttttcttgta
     1621 actcatgaca aagtccgtcc tcattgccac tgagaggtgt ttaatgtgat ccaagacctc
     1681 tctgtgaaac attacccccg caaaccactc agcaaagtgc ctttctccaa gcaagaacaa
     1741 agagctcttg gtggtgactg ctagaaaatt atggaagccc actcatttat gtcagtggac
     1801 tgcaactgtg tacctgtgca atgtttacag atggaaaggg tgaggagatg ctacacctga
     1861 gctaggtatc tcctatataa ccaaagtttc cagcagggaa ggaactagac aatcatcagt
     1921 gcagtctcac agaaggcaac actggaagtg atgtcataag gttgtgatgt gtgcacggta
     1981 tggcacaggt gggatgcaga ggtaacagag tttaaatgaa agtaggatga agctataaag
     2041 aggtttattt atatttatat tgaagctcag gcaagtgcct tgcacacagt aggtacttat
     2101 aactaactgt ggttactgtt ggatatgtga tgttgttaag ggtaagcttg taatacctca
     2161 ccagttctcc ccgagtgatc ttctcttcta agtgagccca ctaattgctg caatggatga
     2221 aattgggtgt ttaatgctgg agagcacatg taggtgacac atgtgccttg aggtatgtga
     2281 ggacatgtaa attagatcca cagtgagctg aggagggctt tccccgccag agtgaggttg
     2341 ggaagcagag ttaatccact tataggatga actgcttggt atttttattg tattgtgact
     2401 gtattacaaa gatggacaat tcactccttg ggagcaagtt atgctctaga agtttattta
     2461 caaatatgct gggcagctct cttgaaatat tttcccaagg aagctattct acacagtggc
     2521 aaaattgcta tctaattaat aatgtagcta aactatgata tttatagtag caaaaaacta
     2581 aattctataa gattgcatta aaggaaagat atattctatt tgctcacttg ggctgcttgg
     2641 tactcacctg ccctccaggt gtactttagg cctgtggagg gtgggcattt agtggtgacc
     2701 cttgcaccag ggttttctaa cagatgaccc tgtgaatcat aatttaaacc tgcatatatt
     2761 ttatagccag tcacatttgc cctctcaccc tatatggcca taaactgcct aagcactcag
     2821 gcctcccact catcaacccc tttgaccaga gaaagaagca ctctggttct ctatcccctt
     2881 gtcacataga gagtttgtca tggggcctct ggctgtgccc ttcacataac agaatgactt
     2941 gccatctgcc tgcaccaaac ccagggatgt ggaagacatc tccccacaac tgccactgct
     3001 caccaggaca agctgccctt cctgtctcca cctctcagtc cccctagaat ggatggctgg
     3061 ggagaggtgg aggctgacag ctgagacgta gtgtcagata tgatctagga gggcggatca
     3121 ccgggatccg ggaccataca agtaacatgg tttccatggc aactgcttgc tcctttgaat
     3181 taagacagca gtcagttgtc attgccatga caaggcctct atctccaggc acaatgtccc
     3241 tgctgtctcc taatccaatg gacttgctct caccccaggg atgaaacacc cagaaactca
     3301 cttctcagtc acttccacag ccgatgactc agaagagcca aacccagaat ggggcctctc
     3361 ttttccccat cacagactcc cctgacaacc tttcctggcg taactagagg agtcccagtg
     3421 caggataggc cctaaacgtt ttgttaaata aacaggtgca tgaaaggagc ctaaggccat
     3481 tgttgatatc cactctcttc tttccacttc cttctcatct ttttctccat gttttatgct
     3541 tctctgattc cctcttctgc ctgcaccaga ccagccccag ccctttattc ctctccattt
     3601 tcactccttc cagcctctgt ccctgaactg ccactggcaa cccatgggac ctcaggacca
     3661 gagactgctt gactcatctg gggagggtaa gttcacgggg gacaaaaaaa tgattcctaa
     3721 agaagaggct tcctagacca gcacaggctc gagaaagaca tcccctaggc ctggacttct
     3781 gagcagcttt agccaggctc cggacggcag ccagaggagg cctttcccca ttgctccttt
     3841 ccccattgct caatggattc catgtttctt tttcttgggg ggagcaggga gggagaaagg
     3901 tagaaaaatg gcagccacct ttccaagaaa aatataaagg gtccaagctg tatagtattt
     3961 gtcagtattt ttttctgtaa aattcaaaca cacacaaaag aaaaatttat ttaaataaaa
     4021 tactttgaaa atgaaaagtc ttgatgtagt cagatggtta ctctcttaac attaggtatt
     4081 acccccactc agacatcact cagaaatgat caatgcaggg actctttctg tgacacaaat
     4141 gtcccagccc tccctggtca ccgccttcgc catggtagag tcataggtct gaggatgagg
     4201 aatgtggctg tctcaccctt gcttgcaaaa cagatggcct tggagaccag actccctcaa
     4261 aggtgccagc tacaggaaaa atatactgat gttccttggc aacacttaca gaactttcca
     4321 tcaatgaggt ccatcaatgg cttcttaaag gaaaaggggg gaaatagcaa aaacctaagg
     4381 aagaatggac ctttgagtta aatccagtgt ttgttgggaa aggagggatc aaaaacctct
     4441 atagtagcca ctagggcaaa aactgtgtgt atgtgtgtgt gtaagtgtgt gtacactgtt
     4501 caatatggtt caatatggta ccaatagcca catgtgacta tttaaattca ttgcaatgaa
     4561 ataaaattaa aggtatacta gctc
//

http://nanoworld.org.ru/post/82323/#p82323

FT CDS 558..857
     tcccacgacc ttggccggcg ccggggccct acacgccaga cctggctcgg ggtgggagtg
     cagaggcaac caaaaaggaa cccacacctc cctccagggc ccggggcgct gtcagacggg
     gcagcaacca ggagattccc tgggcctgca ggaagccctt ccgcggaccg aaagattgtt
     ccccattttg gagatgaaga aactgagact caaagcagct gagtgacctt cccaaggaca
     cacactgaac tgggcggtga tcaggatctg aatgcacagg gcgggtgttc agcgattgtt
     tactacgttg aacgtgacct ccaggaaagc agttctggcc gagatcccct gacaacgcaa
     agcaagaagt aacgtggaag gaggctcccc aagctggctg gccattttgc tgctgtgtgt
     ggaggtgctg ccagtggcat gcccaaaccc aaagctggaa gaggaataaa ttacaagtgg
     tcaaggttgc atccttttga gcccaggacc tgcttgtaag ccgagagggt tctctggccc
     taatctagcc aagcaccatg gagagaatca gtgccttctt cagctctatc tgggacacca
     tcttgaccaa acaccaagaa ggcatctaca acaccatctg cctgggagtc ctcctgggcc
     tgccactctt ggtgatcatc acactcctct tcatctgttg ccattgctgc tggagcccac
     caggcaagag gggccagcag ccagagaaga acaagaagaa gaagaagaag aagaagaaga
     aggatgaaga agacctctgg atctctgctc aacccaagct tctccagatg gagaagagac
     catcactgcc tgtttagtta ggcaggaagc agaggtgttt cctttctggg gctaagcctc
     cttctgacca cacacagaca tttcaggaac ccctgaaata atgcactatg tccatgtcca
     cagagtaact actcaaccaa ggaacaaacc tcagactaag tgtcccagtg gagggcagtc
     ccagggacca cgtggacaat tcttggatac tgtcttggca gctatgtgtc caatagcaat
     gctccttact gcagacccag gcatgcctcc cacctgtctc tggcataccc cacatgcaaa
     gcacaaagaa catttatcca tacatctcaa tatggttccc aagtgtgtgc acatgcacgt
     aacacacaca cacacaaatt caggtagcag gtacgtgggc aagtatattc tgctcatcaa
     atggtcattg gctatgtact ttgtgcaggg aagtacatta tctacagtca caaaaatgtc
     tcatgggaaa gccttgccag attcagacac atatatacaa tttcctaacc agcaaggccc
     ccatacacca tctattccat aaaccactca ggttacagat gcatgctttc ctatttctaa
     ctctacacat aaacttttac tggaagtact cataattgga cattccagca acctgctaca
     gtccccaccc ttgtgtgtct tgatacagac acaccaagtt tctgtgcctc tgacccctca
     cctgtgccaa gatgtttaaa gtgtgatggt tcaaaattca ttgaaagctc ttttcttgta
     actcatgaca aagtccgtcc tcattgccac tgagaggtgt ttaatgtgat ccaagacctc
     tctgtgaaac attacccccg caaaccactc agcaaagtgc ctttctccaa gcaagaacaa
     agagctcttg gtggtgactg ctagaaaatt atggaagccc actcatttat gtcagtggac
     tgcaactgtg tacctgtgca atgtttacag atggaaaggg tgaggagatg ctacacctga
     gctaggtatc tcctatataa ccaaagtttc cagcagggaa ggaactagac aatcatcagt
     gcagtctcac agaaggcaac actggaagtg atgtcataag gttgtgatgt gtgcacggta
     tggcacaggt gggatgcaga ggtaacagag tttaaatgaa agtaggatga agctataaag
     aggtttattt atatttatat tgaagctcag gcaagtgcct tgcacacagt aggtacttat
     aactaactgt ggttactgtt ggatatgtga tgttgttaag ggtaagcttg taatacctca
     ccagttctcc ccgagtgatc ttctcttcta agtgagccca ctaattgctg caatggatga
     aattgggtgt ttaatgctgg agagcacatg taggtgacac atgtgccttg aggtatgtga
     ggacatgtaa attagatcca cagtgagctg aggagggctt tccccgccag agtgaggttg
     ggaagcagag ttaatccact tataggatga actgcttggt atttttattg tattgtgact
     gtattacaaa gatggacaat tcactccttg ggagcaagtt atgctctaga agtttattta
     caaatatgct gggcagctct cttgaaatat tttcccaagg aagctattct acacagtggc
     aaaattgcta tctaattaat aatgtagcta aactatgata tttatagtag caaaaaacta
     aattctataa gattgcatta aaggaaagat atattctatt tgctcacttg ggctgcttgg
     tactcacctg ccctccaggt gtactttagg cctgtggagg gtgggcattt agtggtgacc
     cttgcaccag ggttttctaa cagatgaccc tgtgaatcat aatttaaacc tgcatatatt
     ttatagccag tcacatttgc cctctcaccc tatatggcca taaactgcct aagcactcag
     gcctcccact catcaacccc tttgaccaga gaaagaagca ctctggttct ctatcccctt
     gtcacataga gagtttgtca tggggcctct ggctgtgccc ttcacataac agaatgactt
     gccatctgcc tgcaccaaac ccagggatgt ggaagacatc tccccacaac tgccactgct
     caccaggaca agctgccctt cctgtctcca cctctcagtc cccctagaat ggatggctgg
     ggagaggtgg aggctgacag ctgagacgta gtgtcagata tgatctagga gggcggatca
     ccgggatccg ggaccataca agtaacatgg tttccatggc aactgcttgc tcctttgaat
     taagacagca gtcagttgtc attgccatga caaggcctct atctccaggc acaatgtccc
     tgctgtctcc taatccaatg gacttgctct caccccaggg atgaaacacc cagaaactca
     cttctcagtc acttccacag ccgatgactc agaagagcca aacccagaat ggggcctctc
     ttttccccat cacagactcc cctgacaacc tttcctggcg taactagagg agtcccagtg
     caggataggc cctaaacgtt ttgttaaata aacaggtgca tgaaaggagc ctaaggccat
     tgttgatatc cactctcttc tttccacttc cttctcatct ttttctccat gttttatgct
     tctctgattc cctcttctgc ctgcaccaga ccagccccag ccctttattc ctctccattt
     tcactccttc cagcctctgt ccctgaactg ccactggcaa cccatgggac ctcaggacca
     gagactgctt gactcatctg gggagggtaa gttcacgggg gacaaaaaaa tgattcctaa
     agaagaggct tcctagacca gcacaggctc gagaaagaca tcccctaggc ctggacttct
     gagcagcttt agccaggctc cggacggcag ccagaggagg cctttcccca ttgctccttt
     ccccattgct caatggattc catgtttctt tttcttgggg ggagcaggga gggagaaagg
     tagaaaaatg gcagccacct ttccaagaaa aatataaagg gtccaagctg tatagtattt
     gtcagtattt ttttctgtaa aattcaaaca cacacaaaag aaaaatttat ttaaataaaa
     tactttgaaa atgaaaagtc ttgatgtagt cagatggtta ctctcttaac attaggtatt
     acccccactc agacatcact cagaaatgat caatgcaggg actctttctg tgacacaaat
     gtcccagccc tccctggtca ccgccttcgc catggtagag tcataggtct gaggatgagg
     aatgtggctg tctcaccctt gcttgcaaaa cagatggcct tggagaccag actccctcaa
     aggtgccagc tacaggaaaa atatactgat gttccttggc aacacttaca gaactttcca
     tcaatgaggt ccatcaatgg cttcttaaag gaaaaggggg gaaatagcaa aaacctaagg
     aagaatggac ctttgagtta aatccagtgt ttgttgggaa aggagggatc aaaaacctct
     atagtagcca ctagggcaaa aactgtgtgt atgtgtgtgt gtaagtgtgt gtacactgtt
     caatatggtt caatatggta ccaatagcca catgtgacta tttaaattca ttgcaatgaa
     ataaaattaa aggtatacta gctc
//

1,1,3,1,3,1,1,1,1,3,1,1,1,1,1,1,1,3,1,3,3,1,1,1,1,1,1,1,4,2,1,1,4,1,4,2,1,1,4,1,1,2,1,1,1,1,3,1,3,1,1,1,1,2,2,1,1,
1,1,1,1,2,1,1,1,1,1,1,1,1,1,1,1,1,1,3,3,3,1,1,1,1,3,3,3,1,1,3,1,1,1,1,1,3,2,2,4,3,3

Вторичная структура (Пикотех): https://img-fotki.yandex.ru/get/148218/ … 8_orig.gif

https://img-fotki.yandex.ru/get/59572/158289418.3bd/0_170115_55d04667_orig.png
Кушелев: В этом белке лизин образует прямой участок альфа-спирали

582

Re: Пикотехнология белков, ДНК, РНК - 2

Формы, механизмы, энергия наномира. Сообщение 84 344

Пикотехнология белков, ДНК, РНК - 2

https://www.ncbi.nlm.nih.gov/protein/10 … CR2ZZS6015

https://www.ncbi.nlm.nih.gov/protein/11 … CR2ZZS6015

     CDS             1..381
        1 maspslerpe kgagksefrn qkpkpenqde selltvpdgw kepafskedn prglleessf
       61 atlfpkyrea ylkecwplvq kalnehhvna tldliegsmt vcttkktfdp yiiirardli
      121 kllarsvsfe qavrilqddv acdiikigsl vrnkerfvkr rqrligpkgs tlkalelltn
      181 cyimvqgntv saigpfsglk evrkvvldtm knihpiynik slmikrelak dselrsqswe
      241 rflpqfkhkn vnkrkepkkk tvkkeytpfp ppqpesqidk elasgeyflk anqkkrqkme
      301 aikakqaeai skrqeernka fippkekpiv kpkeastetk idvasikekv kkaknkklga
      361 ltaeeialkm eadekkkkkk k
//

https://www.ncbi.nlm.nih.gov/nuccore/117676402

Homo sapiens KRR1, small subunit processome component homolog (KRR1), mRNA
NCBI Reference Sequence: NM_007043.6
FASTA Graphics
Go to:
LOCUS       NM_007043               3357 bp    mRNA    linear   PRI 10-SEP-2016
DEFINITION  Homo sapiens KRR1, small subunit processome component homolog
            (KRR1), mRNA.
ACCESSION   NM_007043
VERSION     NM_007043.6
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3357)
  AUTHORS   Evans DM, Zhu G, Dy V, Heath AC, Madden PA, Kemp JP, McMahon G, St
            Pourcain B, Timpson NJ, Golding J, Lawlor DA, Steer C, Montgomery
            GW, Martin NG, Smith GD and Whitfield JB.
  TITLE     Genome-wide association study identifies loci affecting blood
            copper, selenium and zinc
  JOURNAL   Hum. Mol. Genet. 22 (19), 3998-4006 (2013)
   PUBMED   23720494
REFERENCE   2  (bases 1 to 3357)
  AUTHORS   Baltz AG, Munschauer M, Schwanhausser B, Vasile A, Murakawa Y,
            Schueler M, Youngs N, Penfold-Brown D, Drew K, Milek M, Wyler E,
            Bonneau R, Selbach M, Dieterich C and Landthaler M.
  TITLE     The mRNA-bound proteome and its global occupancy profile on
            protein-coding transcripts
  JOURNAL   Mol. Cell 46 (5), 674-690 (2012)
   PUBMED   22681889
REFERENCE   3  (bases 1 to 3357)
  AUTHORS   Castello A, Fischer B, Eichelbaum K, Horos R, Beckmann BM, Strein
            C, Davey NE, Humphreys DT, Preiss T, Steinmetz LM, Krijgsveld J and
            Hentze MW.
  TITLE     Insights into RNA biology from an atlas of mammalian mRNA-binding
            proteins
  JOURNAL   Cell 149 (6), 1393-1406 (2012)
   PUBMED   22658674
REFERENCE   4  (bases 1 to 3357)
  AUTHORS   Bailey SD, Xie C, Do R, Montpetit A, Diaz R, Mohan V, Keavney B,
            Yusuf S, Gerstein HC, Engert JC and Anand S.
  CONSRTM   DREAM investigators
  TITLE     Variation at the NFATC2 locus increases the risk of
            thiazolidinedione-induced edema in the Diabetes REduction
            Assessment with ramipril and rosiglitazone Medication (DREAM) study
  JOURNAL   Diabetes Care 33 (10), 2250-2253 (2010)
   PUBMED   20628086
  REMARK    GeneRIF: Observational study of gene-disease association,
            gene-environment interaction, and pharmacogenomic / toxicogenomic.
            (HuGE Navigator)
REFERENCE   5  (bases 1 to 3357)
  AUTHORS   Ghosh D, Lippert D, Krokhin O, Cortens JP and Wilkins JA.
  TITLE     Defining the membrane proteome of NK cells
  JOURNAL   J Mass Spectrom 45 (1), 1-25 (2010)
   PUBMED   19946888
REFERENCE   6  (bases 1 to 3357)
  AUTHORS   Andersen JS, Lyon CE, Fox AH, Leung AK, Lam YW, Steen H, Mann M and
            Lamond AI.
  TITLE     Directed proteomic analysis of the human nucleolus
  JOURNAL   Curr. Biol. 12 (1), 1-11 (2002)
   PUBMED   11790298
REFERENCE   7  (bases 1 to 3357)
  AUTHORS   Chan HY, Brogna S and O'Kane CJ.
  TITLE     Dribble, the Drosophila KRR1p homologue, is involved in rRNA
            processing
  JOURNAL   Mol. Biol. Cell 12 (5), 1409-1419 (2001)
   PUBMED   11359931
REFERENCE   8  (bases 1 to 3357)
  AUTHORS   Sasaki T, Toh-E A and Kikuchi Y.
  TITLE     Yeast Krr1p physically and functionally interacts with a novel
            essential Kri1p, and both proteins are required for 40S ribosome
            biogenesis in the nucleolus
  JOURNAL   Mol. Cell. Biol. 20 (21), 7971-7979 (2000)
   PUBMED   11027267
REFERENCE   9  (bases 1 to 3357)
  AUTHORS   Gromadka R, Kaniak A, Slonimski PP and Rytka J.
  TITLE     A novel cross-phylum family of proteins comprises a KRR1 (YCL059c)
            gene which is essential for viability of Saccharomyces cerevisiae
            cells
  JOURNAL   Gene 171 (1), 27-32 (1996)
   PUBMED   8675026
REFERENCE   10 (bases 1 to 3357)
  AUTHORS   Epplen C and Epplen JT.
  TITLE     Expression of (cac)n/(gtg)n simple repetitive sequences in mRNA of
            human lymphocytes
  JOURNAL   Hum. Genet. 93 (1), 35-41 (1994)
   PUBMED   7505766
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BM839950.1, BC005225.1 and AC121761.4.
            On Nov 10, 2006 this sequence version replaced gi:37059784.
           
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
           
            ##Evidence-Data-START##
            Transcript exon combination :: BC033887.2, BC026107.2 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           SAMEA1965299, SAMEA1966682
                                           [ECO:0000350]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-5                 BM839950.1         1-5
            6-1098              BC005225.1         1-1093
            1099-3357           AC121761.4         167790-170048       c
FEATURES             Location/Qualifiers
     source          1..3357
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="12"
                     /map="12q21.2"
     gene            1..3357
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /note="KRR1, small subunit processome component homolog"
                     /db_xref="GeneID:11103"
                     /db_xref="HGNC:HGNC:5176"
                     /db_xref="MIM:612817"
     exon            1..126
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /inference="alignment:Splign:1.39.8"
     CDS             42..1187
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /note="Rev interacting protein; rev-interacting protein 1;
                     HIV-1 Rev-binding protein 2; KRR-R motif-containing
                     protein 1; KRR1, small subunit (SSU) processome component,
                     homolog; HIV-1 rev binding protein 2"
                     /codon_start=1
                     /product="KRR1 small subunit processome component homolog"
                     /protein_id="NP_008974.5"
                     /db_xref="CCDS:CCDS9012.1"
                     /db_xref="GeneID:11103"
                     /db_xref="HGNC:HGNC:5176"
                     /db_xref="MIM:612817"
                     /translation="MASPSLERPEKGAGKSEFRNQKPKPENQDESELLTVPDGWKEPA
                     FSKEDNPRGLLEESSFATLFPKYREAYLKECWPLVQKALNEHHVNATLDLIEGSMTVC
                     TTKKTFDPYIIIRARDLIKLLARSVSFEQAVRILQDDVACDIIKIGSLVRNKERFVKR
                     RQRLIGPKGSTLKALELLTNCYIMVQGNTVSAIGPFSGLKEVRKVVLDTMKNIHPIYN
                     IKSLMIKRELAKDSELRSQSWERFLPQFKHKNVNKRKEPKKKTVKKEYTPFPPPQPES
                     QIDKELASGEYFLKANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKE
                     ASTETKIDVASIKEKVKKAKNKKLGALTAEEIALKMEADEKKKKKKK"
     misc_feature    45..47
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="N-acetylalanine. {ECO:0000244|PubMed:19413330,
                     ECO:0000244|PubMed:20068231, ECO:0000244|PubMed:21406692,
                     ECO:0000269|Ref.6}; propagated from UniProtKB/Swiss-Prot
                     (Q13601.4); acetylation site"
     misc_feature    48..50
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine. {ECO:0000244|PubMed:20068231,
                     ECO:0000244|PubMed:21406692, ECO:0000244|PubMed:23186163};
                     propagated from UniProtKB/Swiss-Prot (Q13601.4);
                     phosphorylation site"
     misc_feature    54..56
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine. {ECO:0000244|PubMed:23186163};
                     propagated from UniProtKB/Swiss-Prot (Q13601.4);
                     phosphorylation site"
     exon            127..299
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /inference="alignment:Splign:1.39.8"
     exon            300..434
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /inference="alignment:Splign:1.39.8"
     exon            435..560
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /inference="alignment:Splign:1.39.8"
     STS             450..611
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /standard_name="KRR1"
                     /db_xref="UniSTS:506336"
     exon            561..644
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /inference="alignment:Splign:1.39.8"
     exon            645..701
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /inference="alignment:Splign:1.39.8"
     exon            702..872
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /inference="alignment:Splign:1.39.8"
     STS             872..1021
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /standard_name="SGC32697"
                     /db_xref="UniSTS:45678"
     exon            873..950
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /inference="alignment:Splign:1.39.8"
     STS             884..1020
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /standard_name="29485"
     STS             948..1077
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /standard_name="RH47132"
                     /db_xref="UniSTS:4654"
     exon            951..1044
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /inference="alignment:Splign:1.39.8"
     exon            1045..3357
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /inference="alignment:Splign:1.39.8"
     STS             1299..1485
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /standard_name="RH46985"
                     /db_xref="UniSTS:67458"
     STS             1461..1724
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /standard_name="RH18004"
                     /db_xref="UniSTS:70991"
     STS             2338..2474
                     /gene="KRR1"
                     /gene_synonym="HRB2; RIP-1"
                     /standard_name="STS-H56474"
                     /db_xref="UniSTS:29485"
ORIGIN     
        1 agaacagttt catttccgga gccaccggaa gcagcttgca aatggcgtct ccctcgctgg
       61 agcggccaga aaaaggcgct ggaaaaagtg aatttcgtaa ccagaagccg aagccggaga
      121 accaagatga atcagaactc cttacggttc ctgatggttg gaaggaacca gctttttcca
      181 aagaggacaa tcccagagga cttttggagg agagcagttt cgcaactttg ttcccaaaat
      241 acagggaagc ttacttgaaa gagtgttggc cattggtgca gaaagcctta aatgaacatc
      301 atgttaatgc aaccctggac ctgatcgaag gcagcatgac tgtttgtact acaaagaaga
      361 cttttgatcc atatatcatc attagggcca gagatctgat aaaactgtta gcaaggagtg
      421 tttcatttga acaggcagta cgaattcttc aggatgatgt tgcatgtgac atcattaaaa
      481 taggttcttt agtaaggaat aaagagagat ttgtaaaacg aagacaacgg cttattggtc
      541 ccaaaggatc tacattgaag gcattggaac tcttaactaa ttgttacatt atggttcagg
      601 gaaacacagt ttcagccatt ggacctttta gtggcttaaa agaggttaga aaagtagtcc
      661 ttgatactat gaagaatatt catccaattt ataacattaa aagcttaatg attaagagag
      721 agttggcaaa agattctgaa ttacgatcac aaagttggga gagatttttg ccacagttca
      781 aacacaaaaa tgtgaataaa cgcaaggaac caaagaaaaa aactgttaag aaagaatata
      841 cgccattccc accaccacaa ccagaaagtc agatcgataa agaattggct agtggtgaat
      901 actttttgaa ggcaaatcag aagaagcggc agaaaatgga agcaataaag gctaaacaag
      961 cagaagccat cagtaagaga caagaggaaa gaaacaaagc atttattcca cctaaggaaa
     1021 aaccaattgt gaaacctaag gaagcttcta ctgaaactaa aattgatgtg gccagcatca
     1081 aggaaaaggt taagaaagca aagaataaga aactgggagc tcttacagct gaagaaattg
     1141 cacttaagat ggaggcagat gaaaagaaaa agaagaaaaa aaagtaacat acccaaaact
     1201 ccttgactag aactatctcc ttttgtaaag gattttgaga tatcaggcat tagttgcctt
     1261 atttgtgaga aattttctga gggctttttt tttttttggt ggtggtggtt gttcatagaa
     1321 gagtgttctt tataaattat attattattg tattttttga aaaatttata cgagaaagtg
     1381 gtatataagt ctttgtatac attacgacca ttgtgattat ccattaaatc cagtgtctga
     1441 tgctattggt tagtaatgat gtcccagcat ttgatgttcc ctctctaatg ataacaagta
     1501 aatatttagg tttatccctt ttgaaagttt ggttttactt ttaacagtcc atgaacagaa
     1561 aattaaggcc tctaaaatca gatcccctag ttactcctct gttctgaatc tggggaagta
     1621 gtaaaccaaa aagacaggga aaaccagata tttagagtcg aagcagcatg caaaaaataa
     1681 taatgttttt aactaatgaa ggctactgga gttactaaga atcacctaaa aatgtgctac
     1741 tgtaccttgc tcattttgca gatttagaag ctgaaacatg ggttaggtta cttactaaaa
     1801 gtccacctgt ggcaacctgc aaataatgct tatttatact aaagatgagt ttatctgata
     1861 gagttaggaa atttcttctt ttgagtaaga gtattgctat aacatatatt tttttctgaa
     1921 atgttttaaa atagaagtac acctaattgt tattggttaa aaaaaaagcc atatgtgaat
     1981 gaggttggtt tttgggtttt ttctttcctg aattgtatta gtccaaaaga actaaattag
     2041 ggtacttgtg ctgtaccaaa atggtaatta taacagacag tattagaatt actgaattaa
     2101 caatgagaaa gagagaagtg tatctgttac gtggatatat gggccagcct ggatatacaa
     2161 cagagtagta acctgtgaaa caaacataga atatcctctt agacattgtt cctcataatg
     2221 cactgacaga attcacatag ctcttaatga aacaatttaa gattgatgta cgtacgtttg
     2281 acttggtctc gctgtcggtt aactgtaaag ttagggggaa gaaagaaaaa aaattaaaag
     2341 ggtagacaca gttgagagtt ttattttaaa aagctaagtc ttataattat gaccattaac
     2401 ttgctttggc tttattgcag tgactttcca agtttaatta ttcaaaactt tttgaactga
     2461 ctgaattaac ttggtatttt taagttgact ttttacataa actttataaa ccttttataa
     2521 aaaggaaact ataccattac tataaatgga aaatcatttt acacatcata cctagcaggt
     2581 aataaaattt aaaaaataaa aattaaatat tagaatgtga gaaatttatt aaaatatagt
     2641 tctaaaaata agtttcttcc tgagaagaat gatactgttt atgatgaatc catagtgaaa
     2701 agacagtgac ctctctttca tccagtctag tatatcacta aatcatcatt acgatgtttg
     2761 gctatcaagt cattaattac tgtcctcctt tcactgagct ttattcaaat tttgacaatc
     2821 agagcactgg gaagaaataa attccacaac tgcctttagc cttctggata ctttctttta
     2881 taaaatagaa accttttcca caccagttct gcagcagtcg ctattagatg ctcgtggtag
     2941 aacccatcaa tcatctggtc ctctgggtac tggtgagcat ccctggtctt catacctgtg
     3001 agtgggcttt gtggtgaatt actgtaaata tgctaccctc acttttcttg gcagttatgt
     3061 cgatgaaatc aagagtgtga tgttctagtt attttttttt atatatattt ttaaatgttc
     3121 aatattcaac tattgaaaca aatgtacatc tgtgaactag ctaaaatcat cttatgtacc
     3181 actaatatgc ccagcacatt ttgtaaaaca gtcctgattt ggcctccaag ggtatttatt
     3241 gaactaccag cagtatctag gagaccacga aggaatacca cgaaggaatt tatgctccag
     3301 tgcttgccat aatttgtctg agaaggaatc tgttaaataa aagcttttat cctctaa
//

Композиционный код:

1,4,3,1,4,4,1,4,2,3,3,1,3,2,3,3,3,3,3,1,1,1,4,1,4,1,1,3,3,3,2,3,1,3,4,3,3,3,3,1,1,3,2,3,3,1,3,1,1,3,1,3,2,3,1,1,1,
1,3,1,2,3,1,1,2,3,1,1,3,3,1,1,3,1,3,1,2,1,4,1,3,1,3,3,3,3,3,3,3,2,1,4,1,4,1,3,1,1,1,3,3,3,3,2,1,1,3,3,3,2,3,1,1,3,
1,1,3,3,4,2,3,4,3,2,1,3,3,2,3,3,1,2,2,2,3,3,1,3,3,3,2,3,1,1,3,3,2,3,3,3,2,1,3,3,1,3,3,2,3,2,3,3,4,3,3,3,1,3,2,3,2,
1,1,2,1,3,1,3,3,3,3,1,3,1,3,1,2,1,2,3,2,1,3,2,3,3,3,1,3,3,1,3,3,3,2,1,3,3,3,1,1,3,3,3,2,3,3,1,3,3,1,3,1,3,1,3,1,1,
2,3,3,3,3,3,2,2,3,3,1,1,3,3,1,2,1,1,3,1,3,3,4,3,3,1,1,3,2,1,3,3,3,3,1,3,3,3,4,2,1,2,2,2,3,2,3,3,1,1,3,3,3,1,3,3,3,
3,1,3,1,1,2,3,1,1,1,4,1,3,1,3,2,2,1,3,3,3,2,3,1,1,3,1,3,3,1,3,3,1,3,2,3,3,2,3,1,3,3,2,3,4,3,3,1,3,3,3,3,3,3,3,3,3,
4,1,1,1,1,3,1,3,1,3,2,1,3,1,3,4,2,3,3,2,3,3,3,3,2,3,1,1,1,2,3,3,1,3,1,1,3,3,1


Вторичная структура (Пикотех):

https://img-fotki.yandex.ru/get/45704/1 … d_orig.gif

https://img-fotki.yandex.ru/get/106972/158289418.3be/0_17013e_3a317ba0_orig.png
Вот такой лизиновый "хвост"...

583

Re: Пикотехнология белков, ДНК, РНК - 2

Формы, механизмы, энергия наномира. Сообщение 84 364

Пикотехнология белков, ДНК, РНК - 2

http://www.rcsb.org/pdb/explore/explore … ureId=1OJV

https://img-fotki.yandex.ru/get/197852/158289418.3be/0_1701f4_507a862a_XL.png
Кушелев: Вы ещё верите в надёжность РСА? smile

http://www.uniprot.org/uniprot/P08174

http://www.ebi.ac.uk/ena/data/view/AAA52169

>ENA|AAA52169|AAA52169.1 Homo sapiens (human) decay-accelerating factor
ATGACCGTCGCGCGGCCGAGCGTGCCCGCGGCGCTGCCCCTCCTCGGGGAGCTGCCCCGG
CTGCTGCTGCTGGTGCTGTTGTGCCTGCCGGCCGTGTGGGGTGACTGTGGCCTTCCCCCA
GATGTACCTAATGCCCAGCCAGCTTTGGAAGGCCGTACAAGTTTTCCCGAGGATACTGTA
ATAACGTACAAATGTGAAGAAAGCTTTGTGAAAATTCCTGGCGAGAAGGACTCAGTGATC
TGCCTTAAGGGCAGTCAATGGTCAGATATTGAAGAGTTCTGCAATCGTAGCTGCGAGGTG
CCAACAAGGCTAAATTCTGCATCCCTCAAACAGCCTTATATCACTCAGAATTATTTTCCA
GTCGGTACTGTTGTGGAATATGAGTGCCGTCCAGGTTACAGAAGAGAACCTTCTCTATCA
CCAAAACTAACTTGCCTTCAGAATTTAAAATGGTCCACAGCAGTCGAATTTTGTAAAAAG
AAATCATGCCCTAATCCGGGAGAAATACGAAATGGTCAGATTGATGTACCAGGTGGCATA
TTATTTGGTGCAACCATCTCCTTCTCATGTAACACAGGGTACAAATTATTTGGCTCGACT
TCTAGTTTTTGTCTTATTTCAGGCAGCTCTGTCCAGTGGAGTGACCCGTTGCCAGAGTGC
AGAGAAATTTATTGTCCAGCACCACCACAAATTGACAATGGAATAATTCAAGGGGAACGT
GACCATTATGGATATAGACAGTCTGTAACGTATGCATGTAATAAAGGATTCACCATGATT
GGAGAGCACTCTATTTATTGTACTGTGAATAATGATGAAGGAGAGTGGAGTGGCCCACCA
CCTGAATGCAGAGGAAAATCTCTAACTTCCAAGGTCCCACCAACAGTTCAGAAACCTACC
ACAGTAAATGTTCCAACTACAGAAGTCTCACCAACTTCTCAGAAAACCACCACAAAAACC
ACCACACCAAATGCTCAAGCAACACGGAGTACACCTGTTTCCAGGACAACCAAGCATTTT
CATGAAACAACCCCAAATAAAGGAAGTGGAACCACTTCAGGTACTACCCGTCTTCTATCT
GGGCACACGTGTTTCACGTTGACAGGTTTGCTTGGGACGCTAGTAACCATGGGCTTGCTG
ACTTAG

Композиционный код:

1,1,1,4,4,4,1,4,1,4,4,4,1,1,1,4,1,4,1,4,4,4,4,4,4,4,1,1,4,4,1,4,1,3,1,3,1,3,1,2,3,2,3,3,1,1,2,3,1,3,
1,3,2,3,3,1,1,3,3,2,2,4,1,3,3,3,3,1,3,4,3,3,3,1,1,1,1,2,4,1,1,3,1,1,3,3,1,2,3,3,3,1,1,1,3,3,1,1,1,4,
2,2,1,2,3,3,2,1,1,3,1,3,3,1,3,1,3,3,3,2,1,3,3,3,4,3,3,1,1,3,2,3,1,3,3,3,3,3,2,2,2,3,2,3,1,3,1,3,3,3,
1,1,2,2,1,3,3,3,3,1,3,2,1,3,3,4,2,3,2,2,3,3,1,3,3,2,2,3,1,2,3,3,3,2,1,1,1,1,2,3,1,2,4,1,3,3,3,1,4,3,
3,3,3,3,3,3,2,1,1,3,1,1,1,3,1,4,1,2,1,1,3,3,3,3,3,2,2,2,2,3,3,1,3,2,2,3,3,4,3,3,1,3,3,2,3,3,1,3,2,4,
3,2,3,3,3,2,1,1,1,3,2,1,1,3,3,3,3,3,4,3,3,3,3,2,1,1,3,1,2,2,3,3,1,3,2,3,3,2,3,1,1,1,2,2,2,3,1,3,3,1,
2,2,3,3,2,3,2,3,1,2,2,3,3,1,3,1,1,2,3,1,1,2,2,3,3,3,2,2,4,3,2,3,3,1,1,2,1,1,3,3,3,3,2,1,2,3,3,2,3,2,
1,3,2,3,3,1,3,3,2,3,4,1,4,3,1,4,1,2,3,1,3,4,4,2,2,1,1,1,1,4,3

Вторичная структура (Пикотех): https://img-fotki.yandex.ru/get/53993/1 … 1_orig.gif

https://img-fotki.yandex.ru/get/195648/158289418.3be/0_1701f5_ff17c315_orig.png

https://img-fotki.yandex.ru/get/172684/158289418.3be/0_1701f7_2825f098_orig.png

584

Re: Пикотехнология белков, ДНК, РНК - 2

Формы, механизмы, энергия наномира. Сообщение 84 386

Пикотехнология белков, ДНК, РНК - 2

https://img-fotki.yandex.ru/get/171750/158289418.3bf/0_17023f_4fdfc1e0_orig.jpg

http://www.rcsb.org/pdb/explore/explore … ureId=4RXJ

То же: https://img-fotki.yandex.ru/get/107473/ … 2_orig.gif

Кушелев: Уважаемая Виктория! Как Вам одиночная гнутая спираль в PDB?

И как быть с замыканием лизоцимов на 22-ом и 18-ом аминокислотных остатках?

Если у лизоцима по-Вашему нет структуры, то как он может по композиционному коду правильно замкнуться?

http://nanoworld88.narod.ru/data/025_files/1.gif

585

Re: Пикотехнология белков, ДНК, РНК - 2

Формы, механизмы, энергия наномира. Сообщение 84 388

Пикотехнология белков, ДНК, РНК - 2

http://www.rcsb.org/pdb/explore/explore … ureId=2ND1

http://www.uniprot.org/uniprot/O60885

http://www.ebi.ac.uk/ena/data/view/AAL26987

>ENA|AAL26987|AAL26987.1 Homo sapiens (human) bromodomain-containing 4
ATGTCTGCGGAGAGCGGCCCTGGGACGAGATTGAGAAATCTGCCAGTAATGGGGGATGGA
CTAGAAACTTCCCAAATGTCTACAACACAGGCCCAGGCCCAACCCCAGCCAGCCAACGCA
GCCAGCACCAACCCCCCGCCCCCAGAGACCTCCAACCCTAACAAGCCCAAGAGGCAGACC
AACCAACTGCAATACCTGCTCAGAGTGGTGCTCAAGACACTATGGAAACACCAGTTTGCA
TGGCCTTTCCAGCAGCCTGTGGATGCCGTCAAGCTGAACCTCCCTGATTACTATAAGATC
ATTAAAACGCCTATGGATATGGGAACAATAAAGAAGCGCTTGGAAAACAACTATTACTGG
AATGCTCAGGAATGTATCCAGGACTTCAACACTATGTTTACAAATTGTTACATCTACAAC
AAGCCTGGAGATGACATAGTCTTAATGGCAGAAGCTCTGGAAAAGCTCTTCTTGCAAAAA
ATAAATGAGCTACCCACAGAAGAAACCGAGATCATGATAGTCCAGGCAAAAGGAAGAGGA
CGTGGGAGGAAAGAAACAGGGACAGCAAAACCTGGCGTTTCCACGGTACCAAACACAACT
CAAGCATCGACTCCTCCGCAGACCCAGACCCCTCAGCCGAATCCTCCTCCTGTGCAGGCC
ACGCCTCACCCCTTCCCTGCCGTCACCCCGGACCTCATCGTCCAGACCCCTGTCATGACA
GTGGTGCCTCCCCAGCCACTGCAGACGCCCCCGCCAGTGCCCCCCCAGCCACAACCCCCA
CCCGCTCCAGCTCCCCAGCCCGTACAGAGCCACCCACCCATCATCGCGGCCACCCCACAG
CCTGTGAAGACAAAGAAGGGAGTGAAGAGGAAAGCAGACACCACCACCCCCACCACCATT
GACCCCATTCACGAGCCACCCTCGCTGCCCCCGGAGCCCAAGACCACCAAGCTGGGCCAG
CGGCGGGAGAGCAGCCGGCCTGTGAAACCTCCAAAGAAGGACGTGCCCGACTCTCAGCAG
CACCCAGCACCAGAGAAGAGCAGCAAGGTCTCGGAGCAGCTCAAGTGCTGCAGCGGCATC
CTCAAGGAGATGTTTGCCAAGAAGCACGCCGCCTACGCCTGGCCCTTCTACAAGCCTGTG
GACGTGGAGGCACTGGGCCTACACGACTACTGTGACATCATCAAGCACCCCATGGACATG
AGCACAATCAAGTCTAAACTGGAGGCCCGTGAGTACCGTGATGCTCAGGAGTTTGGTGCT
GACGTCCGATTGATGTTCTCCAACTGCTATAAGTACAACCCTCCTGACCATGAGGTGGTG
GCCATGGCCCGCAAGCTCCAGGATGTGTTCGAAATGCGCTTTGCCAAGATGCCGGACGAG
CCTGAGGAGCCAGTGGTGGCCGTGTCCTCCCCGGCAGTGCCCCCTCCCACCAAGGTTGTG
GCCCCGCCCTCATCCAGCGACAGCAGCAGCGATAGCTCCTCGGACAGTGACAGTTCGACT
GATGACTCTGAGGAGGAGCGAGCCCAGCGGCTGGCTGAGCTCCAGGAGCAGCTCAAAGCC
GTGCACGAGCAGCTTGCAGCCCTCTCTCAGCCCCAGCAGAACAAACCAAAGAAAAAGGAG
AAAGACAAGAAGGAAAAGAAAAAAGAAAAGCACAAAAGAAAAGAGGAAGTGGAAGAGAAT
AAAAAAAGCAAAGCCAAGGAACCTCCTCCTAAAAAGACGAAGAAAAATAATAGCAGCAAC
AGCAATGTGAGCAAGAAGGAGCCAGCGCCCATGAAGAGCAAGCCCCCTCCCACGTATGAG
TCGGAGGAAGAGGACAAGTGCAAGCCTATGTCCTATGAGGAGAAGCGGCAGCTCAGCTTG
GACATCAACAAGCTCCCCGGCGAGAAGCTGGGCCGCGTGGTGCACATCATCCAGTCACGG
GAGCCCTCCCTGAAGAATTCCAACCCCGACGAGATTGAAATCGACTTTGAGACCCTGAAG
CCGTCCACACTGCGTGAGCTGGAGCGCTATGTCACCTCCTGTTTGCGGAAGAAAAGGAAA
CCTCAAGCTGAGAAAGTTGATGTGATTGCCGGCTCCTCCAAGATGAAGGGCTTCTCGTCC
TCAGAGTCGGAGAGCTCCAGTGAGTCCAGCTCCTCTGACAGCGAAGACTCCGAAACAGAG
ATGGCTCCGAAGTCAAAAAAGAAGGGGCACCCCGGGAGGGAGCAGAAGAAGCACCATCAT
CACCACCATCAGCAGATGCAGCAGGCCCCGGCTCCTGTGCCCCAGCAGCCGCCCCCGCCT
CCCCAGCAGCCCCCACCGCCTCCACCTCCGCAGCAGCAACAGCAGCCGCCACCCCCGCCT
CCCCCACCCTCCATGCCGCAGCAGGCAGCCCCGGCGATGAAGTCCTCGCCCCCACCCTTC
ATTGCCACCCAGGTGCCCGTCCTGGAGCCCCAGCTCCCAGGCAGCGTCTTTGACCCCATC
GGCCACTTCACCCAGCCCATCCTGCACCTGCCGCAGCCTGAGCTGCCCCCTCACCTGCCC
CAGCCGCCTGAGCACAGCACTCCACCCCATCTCAACCAGCACGCAGTGGTCTCTCCTCCA
GCTTTGCACAACGCACTACCCCAGCAGCCATCACGGCCCAGCAACCGAGCCGCTGCCCTG
CCTCCCAAGCCCGCCCGGCCCCCAGCCGTGTCACCAGCCTTGACCCAAACACCCCTGCTC
CCACAGCCCCCCATGGCCCAACCCCCCCAAGTGCTGCTGGAGGATGAAGAGCCACCTGCC
CCACCCCTCACCTCCATGCAGATGCAGCTGTACCTGCAGCAGCTGCAGAAGGTGCAGCCC
CCTACGCCGCTACTCCCTTCCGTGAAGGTGCAGTCCCAGCCCCCACCCCCCCTGCCGCCC
CCACCCCACCCCTCTGTGCAGCAGCAGCTGCAGCAGCAGCCGCCACCACCCCCACCACCC
CAGCCCCAGCCTCCACCCCAGCAGCAGCATCAGCCCCCTCCACGGCCCGTGCACTTGCAG
CCCATGCAGTTTTCCACCCACATCCAACAGCCCCCGCCACCCCAGGGCCAGCAGCCCCCC
CATCCGCCCCCAGGCCAGCAGCCACCCCCGCCGCAGCCTGCCAAGCCTCAGCAAGTCATC
CAGCACCACCATTCACCCCGGCACCACAAGTCGGACCCCTACTCAACCGGTCACCTCCGC
GAAGCCCCCTCCCCGCTTATGATACATTCCCCCCAGATGTCACAGTTCCAGAGCCTGACC
CACCAGTCTCCACCCCAGCAAAACGTCCAGCCTAAGAAACAGGAGCTGCGTGCTGCCTCC
GTGGTCCAGCCCCAGCCCCTCGTGGTGGTGAAGGAGGAGAAGATCCACTCACCCATCATC
CGCAGCGAGCCCTTCAGCCCCTCGCTGCGGCCGGAGCCCCCCAAGCACCCGGAGAGCATC
AAGGCCCCCGTCCACCTGCCCCAGCGGCCGGAAATGAAGCCTGTGGATGTCGGGAGGCCT
GTGATCCGGCCCCCAGAGCAGAACGCACCGCCACCAGGGGCCCCTGACAAGGACAAACAG
AAACAGGAGCCGAAGACTCCAGTTGCGCCCAAAAAGGACCTGAAAATCAAGAACATGGGC
TCCTGGGCCAGCCTAGTGCAGAAGCATCCGACCACCCCCTCCTCCACAGCCAAGTCATCC
AGCGACAGCTTCGAGCAGTTCCGCCGCGCCGCTCGGGAGAAAGAGGAGCGTGAGAAGGCC
CTGAAGGCTCAGGCCGAGCACGCTGAGAAGGAGAAGGAGCGGCTGCGGCAGGAGCGCATG
AGGAGCCGAGAGGACGAGGATGCGCTGGAGCAGGCCCGGCGGGCCCATGAGGAGGCACGT
CGGCGCCAGGAGCAGCAGCAGCAGCAGCGCCAGGAGCAACAGCAGCAGCAGCAACAGCAA
GCAGCTGCGGTGGCTGCCGCCGCCACCCCACAGGCCCAGAGCTCCCAGCCCCAGTCCATG
CTGGACCAGCAGAGGGAGTTGGCCCGGAAGCGGGAGCAGGAGCGAAGACGCCGGGAAGCC
ATGGCAGCTACCATTGACATGAATTTCCAGAGTGATCTATTGTCAATATTTGAAGAAAAT
CTTTTCTGA

Композиционный код:

1,3,4,1,1,1,3,4,4,3,1,3,3,4,2,2,1,4,3,2,2,3,3,1,3,1,3,2,2,1,1,1,1,3,1,1,2,1,1,2,1,1,1,1,1,4,1,2,1,1,
1,1,3,1,1,1,1,1,1,1,1,3,4,3,1,4,1,3,4,4,1,1,2,2,1,3,1,1,3,2,1,3,1,1,1,3,4,3,1,1,1,4,1,1,3,3,1,3,1,1,
3,3,4,3,1,3,1,2,2,2,1,1,1,1,3,1,1,3,1,1,3,3,1,3,3,1,1,1,1,1,3,1,3,2,3,3,1,1,1,1,1,3,2,3,1,2,1,3,1,2,
3,3,4,3,1,1,1,1,3,3,2,3,1,2,1,2,3,3,1,1,1,1,2,1,1,2,3,2,3,2,3,4,1,3,3,2,4,2,2,3,3,1,3,1,4,2,2,1,2,3,
3,2,4,3,3,4,1,1,1,1,3,1,4,3,3,3,3,4,1,1,4,3,1,1,1,3,1,1,1,4,1,1,1,1,1,1,3,1,1,2,4,4,3,1,1,2,4,1,4,1,
4,2,4,1,1,1,2,3,1,2,1,3,2,3,1,1,1,2,1,1,1,2,1,1,1,4,1,1,2,1,3,4,1,2,1,1,2,4,1,1,3,2,1,1,1,1,1,1,1,3,
1,1,3,1,1,2,1,4,4,1,4,1,1,1,1,1,1,4,1,1,4,4,1,1,1,4,3,4,3,3,2,1,1,1,4,1,1,3,1,1,1,2,2,2,1,1,1,1,1,1,
4,1,1,1,1,1,1,1,1,1,1,1,1,1,3,1,1,1,1,1,1,1,1,1,1,1,1,1,3,4,1,4,1,2,4,1,2,1,1,1,3,1,1,1,1,1,1,1,1,1,
1,2,1,1,3,3,4,1,1,3,1,1,3,3,3,1,1,3,3,3,1,1,2,1,1,1,1,1,1,3,1,1,1,3,3,1,3,1,4,4,1,1,1,1,1,1,1,3,4,1,
3,1,1,3,1,1,1,4,1,1,3,1,1,2,4,4,1,4,1,1,4,2,4,1,3,1,1,1,3,4,1,4,1,2,1,1,1,1,1,1,3,1,1,4,1,3,1,3,4,3,
3,1,3,1,1,1,2,1,1,4,4,3,1,1,1,1,1,1,3,1,4,1,1,1,3,2,1,1,3,1,1,1,1,1,3,2,1,3,1,1,3,1,1,1,3,1,3,3,3,1,
1,3,3,3,1,3,4,3,1,3,3,3,1,3,1,1,3,3,3,3,3,1,4,1,3,3,3,1,1,1,1,3,4,1,1,1,1,2,4,1,1,1,1,1,1,3,1,4,3,1,
4,1,3,1,1,1,1,1,3,1,1,3,1,1,1,4,1,1,1,1,1,1,1,1,1,1,1,1,1,4,1,1,4,4,1,1,1,1,2,4,1,1,1,4,1,3,1,1,1,1,
1,3,3,1,1,3,1,1,4,1,4,1,2,4,3,1,4,1,1,3,1,1,1,3,1,4,1,3,1,3,3,3,3,1,3,3,3,4,3,1,1,1,1,1,1,1,1,1,4,1,
2,1,4,1,1,1,3,1,1,1,1,3,1,1,3,1,1,3,2,1,1,3,4,1,2,3,1,1,4,1,1,4,1,1,1,1,1,1,3,3,1,1,3,1,1,1,1,1,1,4,
3,3,4,1,1,1,4,1,4,3,1,1,1,1,2,4,3,2,3,4,1,1,3,1,1,4,2,1,4,3,1,2,1,1,1,4,1,1,2,1,4,4,1,1,1,4,1,2,1,1,
3,1,1,1,4,1,1,4,1,1,1,1,2,1,1,1,3,1,1,1,1,1,1,1,1,1,1,4,1,4,4,1,3,1,4,1,3,1,4,1,1,4,3,1,1,1,3,2,1,3,
1,1,1,1,2,4,1,3,3,2,3,1,1,1,2,2,1,1,1,2,2,4,1,1,1,2,1,3,1,4,3,1,1,1,1,4,1,2,1,4,2,2,1,1,1,3,2,1,4,1,
2,1,1,1,1,1,3,1,1,3,4,4,4,1,3,3,1,2,3,1,2,1,1,1,1,1,1,1,1,4,1,4,1,1,4,1,1,4,1,1,3,4,4,2,1,3,1,4,1,4,
1,1,1,1,2,1,1,4,4,1,2,1,1,1,3,4,1,1,1,4,1,1,1,4,2,2,1,2,2,1,1,1,1,3,2,1,1,1,1,3,1,1,3,2,4,1,4,1,1,1,
1,1,1,3,1,1,1,1,3,1,1,4,2,1,1,1,1,1,1,1,3,4,1,2,1,1,1,2,1,4,4,1,3,1,1,3,1,3,1,1,1,1,1,3,2,1,4,1,1,1,
4,1,1,1,2,1,3,1,1,1,3,1,1,1,4,3,1,2,3,1,1,1,1,2,1,1,1,1,4,1,1,1,3,2,1,1,3,1,1,1,3,1,3,1,1,4,3,3,1,1,
4,1,1,1,1,1,1,4,4,4,1,1,1,1,1,1,2,1,1,1,1,1,1,1,1,1,1,4,4,4,4,1,1,1,1,1,4,1,1,1,1,1,1,1,1,4,1,1,4,4,
3,1,1,3,4,3,1,4,1,3,4,1,4,1,2,1,1,1,2,4,2,2,4,1,3,1,1,1,3,1,3,1,1,4,1,3,2,3,4,1,3,1,1,4,3,1,1,1,1,1,
1,1,1,1,2,4,1,1,3,4,1,1,1,1,1,2,1,1,2,1,1,1,1,1,1,1,1,1,1,1,3,4,1,3,1,1,3,1,1,1,4,1,3,1,1,1,1,3,1,1,
1,1,1,4,4,4,1,1,1,1,1,1,2,1,1,1,3,4,4,1,1,1,4,4,1,3,1,1,2,3,4,1,1,1,1,1,1,1,1,1,1,1,3,1,1,1,1,3,1,3,
2,3,4,4,3,1,1,1,1,2,1,1,1,1,1,1,1,1,1,1,4,1,1,1,1,1,1,1,4,1,4,1,1,1,2,3,1,4,3,1,1,2,3,1,3,1,1,3,1,1,
3,3,2,1,2,2,3,3,3,3,3,1

Вторичная структура (Пикотех): https://img-fotki.yandex.ru/get/195419/ … 4_orig.gif

https://img-fotki.yandex.ru/get/122076/158289418.3bf/0_170243_1d83303d_orig.png
Кушелев: Любопытный фрагмент структуры...

https://img-fotki.yandex.ru/get/224193/158289418.3bf/0_170244_9266a9c0_orig.png

https://img-fotki.yandex.ru/get/95629/158289418.3bf/0_170245_af9b706f_orig.png

https://img-fotki.yandex.ru/get/198488/158289418.3bf/0_170246_38a453a9_orig.png

https://img-fotki.yandex.ru/get/196142/158289418.3bf/0_170247_b39cbdc0_orig.png

https://img-fotki.yandex.ru/get/43388/158289418.3bf/0_170248_c78de507_orig.png

Кушелев: Интересно, что это за участки белка такие необычные?

https://img-fotki.yandex.ru/get/196486/158289418.3bf/0_17025e_97b8bb30_orig.png
Кушелев: Обратите внимание на корреляцию вторичной структуры с аминокислотными остатками. Gln (глутамин) находится в структуре прямой альфа-спирали, а Pro (пролин) в структуре бета-спирали и краёв.

586

Re: Пикотехнология белков, ДНК, РНК - 2

Формы, механизмы, энергия наномира. Сообщение 84 389

Пикотехнология белков, ДНК, РНК - 2

https://img-fotki.yandex.ru/get/196486/158289418.3bf/0_17025e_97b8bb30_orig.png
Кушелев: Все видят корреляцию?

https://img-fotki.yandex.ru/get/196010/158289418.3bf/0_17027c_adf3ee8_orig.png
Такая корреляция наглядно показывает предсказательную силу пикотехнологии даже на уровне 2D-структуры.

https://img-fotki.yandex.ru/get/61266/158289418.3bf/0_17027d_df19ad12_orig.png

https://img-fotki.yandex.ru/get/197923/158289418.3bf/0_17028e_455c9b30_orig.png

https://img-fotki.yandex.ru/get/195637/158289418.3bf/0_1702b1_a19e23f8_orig.png

https://img-fotki.yandex.ru/get/114207/158289418.3bf/0_1702b2_8171e69d_orig.png

https://img-fotki.yandex.ru/get/55918/158289418.3bf/0_1702b3_c5186377_orig.png

Кушелев: Корреляция вторичной структуры по таблице композиционного кода с первичной последовательностью белка, в частности, иминокислоты Pro, очевидна.

А первичная последовательность в отличие от данных РСА имеет 100%-ную надёжность smile

587

Re: Пикотехнология белков, ДНК, РНК - 2

Формы, механизмы, энергия наномира. Сообщение 84 391

Пикотехнология белков, ДНК, РНК - 2

Кушелев: Уважаемая Виктория!
Предлагаю сравнить величину корреляции вторичной структуры по данным разных методов с первичной структурой, в частности по пролину. И сразу выяснится, "Кто есть Who?" smile

А по результатам сравнения имеет смысл написать научную статью, которая может "взорвать" научный мир smile

https://img-fotki.yandex.ru/get/196486/158289418.3bf/0_17025e_97b8bb30_orig.png

Очевидно, что корреляция вторичной структуры с первичной по Pro, полученной по программе Пикотех, выше аналогичной корреляции вторичной структуры из PDB.

https://img-fotki.yandex.ru/get/196245/158289418.3bf/0_1702b6_a70d961_XL.png
http://www.rcsb.org/pdb/explore/explore … ureId=2ND1

Подробнее: http://nanoworld.org.ru/post/82401/#p82401

588

Re: Пикотехнология белков, ДНК, РНК - 2

Формы, механизмы, энергия наномира. Сообщение 84 408

Пикотехнология белков, ДНК, РНК - 2

Victoriy пишет:

Даже композиционный код опровергает это.

Уважаемая Виктория!

А Вы в курсе, что есть участки структуры белка, в которых первичная и вторичная структуры коррелируют на все 100% ?

Есть, например, аминокислоты Met (метионин) и Trp (триптофан), которые рибосома может поставить только под углом альфа-спирали, т.е. единственный вариант композиционного кода "1" smile Конечно, это может быть одиночный альфа-код или в составе спирали, но никак не код "2" или "3" smile Если же из Met и Trp составлен участок белка более 3 аминокислотных остатков, например, -Trp-Met-Trp-Met-, -Trp-Trp-Trp-Trp-Trp- или -Met-Met-Met-Met- то это будет альфа-спираль однозначно.

https://img-fotki.yandex.ru/get/216168/158289418.3c0/0_170316_5d47a46_orig.png
Подробнее: http://nanoworld.org.ru/post/82434/#p82434

https://img-fotki.yandex.ru/get/195561/158289418.3c0/0_170306_707fb10f_orig.png
Подробнее: http://nanoworld.org.ru/post/82429/#p82429

https://img-fotki.yandex.ru/get/98813/158289418.3c0/0_170311_330d22f5_orig.png
Подробнее: http://nanoworld.org.ru/post/82432/#p82432

А это означает 100% корреляцию первичной и вторичной структуры в этом месте.

https://img-fotki.yandex.ru/get/196486/158289418.3bf/0_17025e_97b8bb30_orig.png
Подробнее: http://nanoworld.org.ru/post/82400/#p82400
В случае Pro корреляция, конечно, не 100%, но тоже вполне очевидна smile

Кстати, а что делать с фрагментами лизоцимов, о которых мы с Вами недавно беседовали? Вы нашли код человеческого лизоцима. Оказалось, что его фрагмент тоже замыкается, но не на 22-ом, а на 18-ом остатке.

Если по Вашему алгоритму лизоцим не имеет определённой структуры, то как его фрагмент может замкнуться на уровне композиционного кода? Случайно? Но вероятность случайного замыкания фрагмента из 22 аминокислотных остатков равна 3^-22, а двух разных лизоцимов 3^-22*3^-18=3^-40 Вы верите в случайность найти иголку в стоге сена, размером с Солнце?

http://nanoworld88.narod.ru/data/025_files/1.gif

https://img-fotki.yandex.ru/get/105284/158289418.3bf/0_1702fb_aff0e48a_orig.png
Подробнее: http://nanoworld.org.ru/post/81871/#p81871

Кстати, по Вашему алгоритму фрагмент лизоцима мог бы замкнуться только в треугольник, т.к. состоит из трёх прямых участков альфа-спирали. Либо спирали нужно ломать...

https://img-fotki.yandex.ru/get/112776/158289418.3bf/0_1702fc_2f73e792_orig.png
Подробнее: http://nanoworld.org.ru/post/81852/#p81852

Кстати, с фрагментом второго (человеческого) лизоцима у Вас совсем плохо. Структуры "нет совсем", а по моей модели он тоже замыкается на уровне композиционного кода:

https://img-fotki.yandex.ru/get/218579/158289418.3b3/0_16f621_2cbc61c5_XL.png
Вы верите в две случайности подряд с вероятностями 3^-22 и 3^-18 ?

589

Re: Пикотехнология белков, ДНК, РНК - 2

Формы, механизмы, энергия наномира. Сообщение 84 411

Готовится 585-ый выпуск рассылки "Новости лаборатории Наномир"

http://subscribe.ru/catalog/science.news.nanoworldnews

Дайджест:

585 Обнаружена корреляция (местами 100%-ная!) между первичной и вторичной структурами белка.

https://img-fotki.yandex.ru/get/216168/158289418.3c0/0_170316_5d47a46_orig.png

https://img-fotki.yandex.ru/get/195561/158289418.3c0/0_170306_707fb10f_orig.png

https://img-fotki.yandex.ru/get/98813/158289418.3c0/0_170311_330d22f5_orig.png

https://img-fotki.yandex.ru/get/196486/158289418.3bf/0_17025e_97b8bb30_orig.png

590

Re: Пикотехнология белков, ДНК, РНК - 2

Формы, механизмы, энергия наномира. Сообщение 84 412

Пикотехнология белков, ДНК, РНК - 2

https://www.ncbi.nlm.nih.gov/protein/61 … H7J1TPE015

https://www.ncbi.nlm.nih.gov/nuccore/614458216

https://www.ncbi.nlm.nih.gov/nuccore/614458216

FT CDS 310..9819
        1 gggatttccc tcaaagccca gggtccgggg acctggaaag tagaagtgga gggattcaat
       61 tctccgcgcg attgaggcgc tagcggcgga gctggacggc ctgggaaggc ttcggctcct
      121 cggctgcggc tccagcccgg acggcgccgc gcaactttgc catccttctg gcccagcccc
      181 ggctacagga ggaccccgcg ggcaacgcgc ggagttcctg gcacttcccg gcggtgtctc
      241 ttgttgtctg cccggggacc gacttcgcat gctctcaggc tgacctgtcc aagcccgaac
      301 accgggacca tgcactcagc cgggactccc gggttatcct cgcgccggac aggcaactcc
      361 accagctttc aaccaggacc gccaccgccg ccccggctgc tgctgctgct gctgcttctc
      421 ctgtcactgg taagccgcgt cccggcacag cccgctgcct tcggcagggc gttgctgtcc
      481 cctggtctcg cgggggctgc aggggtccct gctgaggagg ccatagtgct ggcgaaccgc
      541 ggactccggg tgcctttcgg ccgtgaagtc tggctggatc ccctgcatga cctggtgttg
      601 caggtgcagc ccggggaccg ctgcgcggtt tcggtactag acaacgacgc actggcccag
      661 cgaccgggcc gcctgagtcc caagcgcttc ccgtgcgact ttggccctgg cgaggtgcgc
      721 tactctcacc tgggcgcgcg cagcccgtct cgggaccgcg tccggctgca gctgcgctat
      781 gacgcgcccg gaggggcagt agtgctacca ctggtactgg aggtggaggt ggtcttcacc
      841 cagctggagg ttgtgactcg gaacttgcct ctggtcgtgg aagagctgct ggggaccagc
      901 aatgccctgg acgcgcggag cctggagttc gccttccagc ccgagacaga ggagtgccgc
      961 gtgggcatcc tgtccggctt gggcgcgctg cctcgctatg gagaactcct ccactacccg
     1021 caggtccctg gaggagccag agagggaggc gccccggaga ctctcctgat ggactgcaaa
     1081 gctttccagg aactaggcgt gcgctatcgc cacacagccg ccagtcgctc accaaacagg
     1141 gactggatac ccatggtggt ggagctgcgt tcacgagggg ctcctgtggg cagccctgct
     1201 ttgaaacgcg agcacttcca ggttctggtg aggatccgag gaggggccga gaacactgca
     1261 cccaagccca gtttcgtggc catgatgatg atggaggtgg accagtttgt actgacggcc
     1321 ctgaccccag acatgctggc agccgaggat gctgagtctc cctctgacct gttgatcttc
     1381 aaccttactt ctccattcca gcctggccag ggctacttgg tgagcaccga tgatcgcagc
     1441 ctgccccttt cctccttcac tcagagggat ctgcggctcc tgaagattgc ctaccagccc
     1501 ccttctgaag actctgacca ggagcgcctc tttgaactgg aattggaggt agtggatcta
     1561 gaaggagcag cttcagaccc ttttgccttc atggtagtgg tgaagcccat gaacacaatg
     1621 gctccggtgg tcacccggaa taccggtctt attctctatg agggtcagtc tcggcccctc
     1681 acaggccctg caggcagtgg tccgcaaaac ttggtcatca gcgatgagga tgacctagaa
     1741 gcagtgcggc tagaggtggt ggctgggctc cggcatggtc accttgtcat tctgggtgct
     1801 tccagtggca gctctgctcc caagagcttt acagtggctg agctggcagc cggccaggtg
     1861 gtctaccagc atgatgacag agacggctcg ctgagcgaca acctggtgct tcgcatggtg
     1921 gatggaggag gcaggcacca ggtacagttt ctgttcccca tcaccttagt gcctgtggat
     1981 gaccagccac ctgttctcaa tgccaacacg gggctgacac tggcagaggg tgaaacagtg
     2041 cccatcctgc ccctttccct gagtgcaact gacatggatt cagatgattc tctgctgctt
     2101 tttgtgctgg agtcaccctt cttaactacg gggcatctgc ttctccgcca aactcaccct
     2161 ccccatgaga agcaggaact tctcagaggc ctttggagga aggagggggc attttatgag
     2221 cgaacagtga cagagtggca gcagcaggac ataacagagg gcaggctgtt ctatagacac
     2281 tctgggcccc atagtcctgg gccagtcaca gaccagttca catttagagt ccaggataac
     2341 catgaccctc ctaatcagtc cgggctacag cggtttgtga ttcgtatcca tcctgtggat
     2401 cgcctccctc cggagctggg cagtggctgt ccccttcgta tggtggtaca ggaatcccag
     2461 ctcacaccac tgaggaagaa gtggctgcgc tacactgacc tggacacaga tgaccgagaa
     2521 ctacgttaca cagtgactca gccccccaca gacacagacg aaaatcacct gccagcccca
     2581 ctgggtacct tggtcttgac tgacaacccc tcagtcgtgg tgacccattt tacccaagcc
     2641 cagatcaacc atcataaaat tgcttacaga cccccgggtc aagaactggg cgtggctact
     2701 cgagtggccc agttccagtt ccaggtggaa gaccgagctg ggaatgtggc tccaggtacc
     2761 tttacccttt acttgcatcc cgtggacaac cagccacctg agatcctcaa caccggcttc
     2821 actattcagg agaagggtca ccacatcctg agtgagacag agttgcacgt gaatgatgta
     2881 gacactgatg ttgcccatat ctctttcact ctcactcagg cacccaaaca tggccacatg
     2941 agagtgtctg gacagatcct gcatgtaggg ggtctcttcc acttggagga cataaaacag
     3001 ggccgagttt cctatgccca taatggggac aagtccctga ctgatagctg ctccttggaa
     3061 gtcagtgaca gacatcatgt ggtgcccatc actctcagag taaatgtccg gccagtggat
     3121 gatgaagtgc ccatactgag ccatcctact ggcactctgg agtcctatct agatgtctta
     3181 gaaaatgggg ctactgaaat cactgccaat gttattaagg ggaccaatga ggaaactgat
     3241 gacttgatgt tgactttcct cttggaagat ccacctttgt atggggaaat cttggtcaat
     3301 ggcattccag cagagcagtt tactcaaagg gacatcttgg agggctctgt tgtatatacc
     3361 cacaccagtg gtgagatagg cctattgcct aaagcggatt cttttaacct gagtctgtca
     3421 gatatgtctc aagaatggag aattggtggc aatactatcc aaggagttac tatatgggtg
     3481 accatcctgc ctgttgatag ccaggcccca gaaatctttg taggtgaaca gttgatagta
     3541 atggaaggtg ataaaagtgt tataacatca gtgcatataa gtgctgaaga tgtcgactcc
     3601 ctgaatgatg acatcttgtg cactatagtt attcagccta cttcaggtta tgttgaaaac
     3661 atttctccag caccaggctc tgagaaatca agagcaggga ttgccataag tgctttcaac
     3721 ttgaaagatc tcaggcaggg ccacataaac tatgtccaga gtgtccataa aggggtggaa
     3781 cctgtggagg accgatttgt atttcgttgt tctgatggca ttaacttttc agagagacag
     3841 ttcttcccca ttgtaatcat tcccaccaat gatgaacagc cagagatgtt tatgagagaa
     3901 tttatggtga tggaaggcat gagtctggta attgatacac ccattctcaa tgctgctgat
     3961 gctgatgttc ccctggatga tttaactttc actattaccc aattccccac tcatggtcac
     4021 atcatgaatc agctgataaa tggcacggtt ttggtcgaaa gcttcacctt ggatcagatc
     4081 atagagagtt ccagcattat ttatgagcat gatgactccg agacccagga agacagtttt
     4141 gtgattaaac taacagatgg gaagcactct gtggaaaaga cggtcctcat tatagttatc
     4201 cctgttgatg atgagacgcc cagaatgact atcaataatg gactagaaat agaaattggg
     4261 gataccaaga ttatcaacaa caaaatatta atggcaacag atttagattc agaagacaaa
     4321 tctttggttt atattattcg ttatgggcca ggacatggct tattacagag acgaaaacct
     4381 actggtgcct ttgaaaatat cacactgggc atgaatttta cccaggatga agtagacaga
     4441 aacttaattc agtatgtcca tttggggcaa gagggcattc gggacctaat taaatttgat
     4501 gtgactgatg gaataaatcc cctcatagat cgttactttt atgtgtccat cgggagcatt
     4561 gacattgtct tccctgatgt gataagtaag ggagtgtcct tgaaagaagg tggcaaagtc
     4621 actcttacaa cagacctact aagcactagt gacttgaaca gtcctgatga aaacttggtt
     4681 tttaccatca ccagggctcc catgcgaggt cacctggaat gcacggatca gcctggtgtg
     4741 tccatcacgt ctttcactca gctgcaactg gctggaaaca aaatctacta catccacaca
     4801 gctgatgatg aagtgaaaat ggacagtttt gagtttcaag tcaccgatgg acgtaaccct
     4861 gtctttcgga cattccgtat ctccattagc gatgtggaca ataaaaagcc agtggtcacc
     4921 atccacaagc tggttgtcag tgaaagtgaa aacaagctga ttactccttt tgagctcact
     4981 gtcgaagaca gagatactcc tgacaagctc ctgaaattca ctatcaccca ggtgcctatt
     5041 catggccatc tcctattcaa caataccaga cctgtcatgg tttttaccaa gcaagacttg
     5101 aatgaaaact taatcagcta caaacatgat ggcactgagt caagtgaaga tagcttctcc
     5161 ttcacagtga ctgatggcac ccatacagac ttctatgttt ttcctgatac ggtgtttgaa
     5221 acaaggagac cccaagtgat gaagatccag gtcttggctg ttgacaacag tgtcccccaa
     5281 atcgcagtga ataagggggc ctctacactt cgcactctag ccactggcca cttggggttc
     5341 atgatcacaa gcaaaatatt gaaagtggag gacagagaca gcttacacat ttctcttaga
     5401 tttatcgtga cagaggcccc tcaacatgga tatcttctca acctggacaa aggcaaccac
     5461 agcatcactc agttcacaca agctgacatt gatgacatga aaatatgcta tgtcttaaga
     5521 gaaggggcta atgccacaag tgatatgttc tattttgcag ttgaagatgg tggtggaaac
     5581 aagttaacgt accagaattt tcgtctgaat tgggcatgga tctcctttga aaaggaatat
     5641 tacctggtca atgaggactc caaatttcta gatgttgttc ttaaacgtag aggttacttg
     5701 ggagaaactt cttttataag tattggcaca agagacagaa ctgcagaaaa agacaaagac
     5761 ttcaagggca aagcacagaa acaagtgcag ttcaacccag gccagaccag ggccacatgg
     5821 cgagtgcgga tcctgagtga tggggagcat gagcagtctg aaacctttca ggtggtactc
     5881 tcagagcccg tgctggctgc cttggaattc cccacagtcg ccactgttga gatcgttgat
     5941 ccaggagatg agccaactgt gtttattccc cagtccaaat actccgttga agaagatgtt
     6001 ggtgagctgt tcattcccat caggaggagc ggagatgtga gccaggagtt gatggtggtc
     6061 tgttataccc aacaaggaac agcaactgga actgtgccga cttccgtgtt gtcttactct
     6121 gattacatat ccaggcctga ggaccacacc agtgttgtcc gctttgacaa agatgaacgg
     6181 gagaaactgt gtcggatagt cataattgat gactctttgt acgaggagga ggaaaccttc
     6241 catgtccttc tgagcatgcc catgggggga agaatcggat cagagttccc aggggctcaa
     6301 gttacaatcg ttcctgacaa agatgatgaa cccatctttt acttcggtga tgtggaatac
     6361 tctgtggatg agagtgctgg ctatgtggaa gtgcaggtgt ggagaacggg cactgacctg
     6421 tccaagtctt ctagtgtcac agtgaggtct cggaaaacag atcctccctc tgcagatgct
     6481 ggaacagact atgtgggcat cagccgtaat ttagattttg cacctggagt caacatgcag
     6541 cctgttcgtg ttgtcattct ggatgacctt ggacaaccag cgctggaggg aattgagaaa
     6601 tttgaactgg tgcttcgcat gcctatgaac gcagcccttg gcgagcccag caaagccaca
     6661 gtgtccataa atgactctgt ctccgatttg cctaagatgc aattcaaaga acgaatatat
     6721 actggcagcg aaagtgatgg gcagatagtt acaatgatcc ataggactgg ggatgtccag
     6781 tacagatctt cagtgagatg ctacacccgg caggggtctg cacaggtgat gatggacttt
     6841 gaagaacgcc caaacactga tacctccatc atcacattcc tccctggtga gacagaaaag
     6901 ccctgcattc ttgagctgat ggacgatgtg ctctatgagg aggtagagga gctccgcctg
     6961 gtactcggca ctccacaaag caactctccc tttggggctg cagttggtga acaaaatgaa
     7021 actctcataa ggatccgaga tgatgctgat aagactgtta ttaaatttgg agaaaccaaa
     7081 tttagtgtca ctgaacccaa agaacctgga gagtcggtgg ttataagaat tccagtgatt
     7141 cgccaaggag acacttcaaa ggtttccatt gtgagagtcc acaccaagga tggctcggcc
     7201 acctctggag aagactacca ccctgtgtca gaagaaattg agtttaagga aggggaaacc
     7261 cagcacgtgg ttgaaatcga agttaccttt gacggggtga gagagatgag agaggccttc
     7321 actgttcacc taaaacctga tgaaaatatg atagcagaga tgcagttgac gaaagccatt
     7381 gtgtacatag aagaaatgag cagcatggca gatgtcactt ttccttctgt ccctcaaatt
     7441 gtatccctgt tgatgtatga cgacacttcc aaagctaagg agagtgctga acccatgtct
     7501 ggctatcctg tcatctgtat cacagcttgc aaccccaaat attcagacta cgataaaaca
     7561 ggctctatct gtgcaagtga gaacatcaat gacactttga cgcggtaccg gtggctgatt
     7621 agtgcacctg cgggccctga cggtgtgacc agccctatga gagaagtgga cttcgacacc
     7681 ttttttacgt catccaagat ggtcacactg gactccatat actttcagcc tggctcccgg
     7741 gtacagtgcg cagctcgtgc tgtgaacacc aatggggatg aaggcctgga gctcatgagc
     7801 cctattgtaa ccatcagcag agaagaaggt ctttgtcagc cccgtgtacc tggggttgtt
     7861 ggagcagagc cgttctcagc taaattgcgc tacacaggcc ctgaggatgc agactacaca
     7921 aaccttatca agctcactgt cacaatgcca cacatagatg gcatgctccc cgtgatctcc
     7981 actagagagc tttccaactt tgagctcacc ctcagccctg atggcacaag agttggaaac
     8041 cacaagtgct ccaacctcct ggattatact gaagtgaaga ctcattatgg tttcttgact
     8101 gatgctacca aaaatccaga aataattgga gagacatatc cttaccagta cagcttgtcc
     8161 atcagaggtt ccactacctt gcgcttctac cggaacctga acctagaggc ctgtttatgg
     8221 gagttcgtta gctactatga catgtcagaa ctccttgctg actgtggtgg caccattgga
     8281 acagatggac aggtcctaaa cctagtgcag tcctatgtga cccttcgagt ccctctgtat
     8341 gtttcctacg tgttccattc ccccgtgggg gtaggaggct ggcagcattt tgacttgaag
     8401 tcagagcttc gtctaacttt tgtgtacgac accgccatct tgtggaatga tggaattggc
     8461 agccccccag aggctgaact tcaaggttct ctctatccaa ccagcatgcg catcggtgat
     8521 gaggggcgct tggccgtgca cttcaagaca gaggctcagt tccatggctt atttgtgctg
     8581 tcacatcccg catcctttac aagctcagtg atcatgtcag ctgatcatcc aggcctgaca
     8641 ttttccctcc gcctcataag gagtgaacca acctataacc agccagtaca gcagtggagc
     8701 tttgtctctg actttgccgt acgtgactac tcagggacct atactgtgaa gctggtgcca
     8761 tgcactgccc catcacatca ggaataccgc ctgccagtca cctgcaaccc cagagaacct
     8821 gtcacctttg accttgacat ccgattccaa caggtcagtg atccagtggc tgctgagttt
     8881 agcttgaaca cccaaatgta cctgctctct aagaagagtc tctggttgtc tgatggatcc
     8941 atgggattcg ggcaagagag tgatgttgct tttgcagaag gtgatataat ttatggtcgt
     9001 gtcatggtgg atcctgtcca gaatctgggt gactcctttt actgcagcat tgagaaggtg
     9061 tttctatgca ctggagctga tggctatgtt cccaagtata gtccaatgaa tgcagaatat
     9121 ggctgcttag ccgactctcc ttcactctta tatagattta aaattgtgga caaagctcag
     9181 ccagagacac aagcgaccag ttttggaaat gtcctattta atgccaaact agcagtggat
     9241 gaccctgaag ccattctctt agtgaatcag cctggatctg atggatttaa agtcgactca
     9301 acaccactct ttcaggtcgc tctaggccga gaatggtata tacatacgat ctatacagtg
     9361 agatcgaaag acaatgccaa tcgaggtatt ggcaaaagaa gtgtggagta ccattctctg
     9421 gtgagtcaag gaaagcccca atccaccacc aagagccgga agaagagaga gatcaggagc
     9481 acaccctcac tggcatggga gattggtgct gaaaacagtc gaggaacaaa catccagcac
     9541 attgccctgg accgcaccaa gaggcagatc ccccatggga gagcacctcc agatggcatc
     9601 ctcccctggg agctcaacag ccccagctct gcagtcagcc tggtcactgt ggtgggaggc
     9661 accacggtag ggttactcac catctgcctc actgtcattg cagtgctgat gtgcaggggc
     9721 aaggaaagtt tcagggggaa ggatgccccg aaaggctcca gcagcagtga gcccatggtg
     9781 cccccacaga gccatcacaa tgacagctca gaagtttgat gactgcaggt agaattcaac
     9841 cttttccgta agtgcctcgg aaaagatcac aatggaacct taaatacttc tggtaaacca
     9901 tagagaatgg aggatggctg tgatgaagct gcttagagaa tatgactgta ctaatggagt
     9961 ttgatttgaa ttctccatac tcttttttgc atcaaaggac aaattaaggc atctttcctc
    10021 ttgccccaaa ggcagcaaca acgtactcat atgtacacag agccatgatg tgaggaatgt
    10081 actcctcatt ttagacatat tctctatgca gtggagataa atctattaaa aggtgctaac
    10141 agactctctt acaagtgtaa gaggaatcta ctgttgctat gttagtgtga atgttgaagg
    10201 tgcaattatc acattgttta ttaattgtat aacagattat tactagaaag gtttttgttg
    10261 ctagtctgga aaactggtga acacactgtt tattatgaca agttttcaaa taggtgaaga
    10321 cagcatagaa ttatgaccag ggtggctcaa cccacaaatc aactgatcta ctacttggga
    10381 gacagtggaa ggaaagatag agggaaggaa gttcactcac ttgaatttga attgcttctc
    10441 attctcatca gactctcctt gttttgtttg catatttaat tttaaattaa accaaagaat
    10501 atgttaattc tgaaagagat ttttaagaga tgctgctctg ttttggcata tagtgagtaa
    10561 tggtagagct cttgcatggt aatatacctt attggtgctc aacatttgtg ggaaattaga
    10621 gggttggtga gattttggtg atgaataaat gccatagagt tagagtcact acaagacaat
    10681 gttctctaag aactgagcct agatgtttgc agtattgaac ccataaatga taataagaaa
    10741 cattgttaca gatggtgaag ggagaaagtg gtatttatta atataatgtg tataatcaga
    10801 gtgcctctta tacatacttt atagaataaa ggaacatttt gacagatgag gttatccctc
    10861 ggagtagcgt aatcacacaa taacatttag aacttaaatt ggctacagga cattttatta
    10921 gctttctatc cagcatctgg tccaaacgat gggactctct gcaactatca ttccagaaat
    10981 ggtcttggag gtggccagaa tcattgacca tatttttatt tggttcaaga agacatcgct
    11041 ctggcatccc cagttcagtg aactggtaca atgtggtccc tctcaatatt taaaaatata
    11101 atttgtaaca gtgcttacca ttcacctccc aaagccaagg aacttgagtg agcttccttg
    11161 gcaagcctcc cattgccttt ctgcatcaat gtgtttgtta ccaaatagca gaaatttcgc
    11221 ttagaagggg aaaacttcag ctttccaaaa gctagtaaac atgtttcaaa gaaaaataag
    11281 gtcaggagaa aaagaataat gcctacagat tatccttcag atgctggcta gaatcccctt
    11341 tgacttctag ccataagctg gccacattgg acatcttggt cactgcagaa ttttaaaagg
    11401 caaacttctc agaacagatg tgcacatctt aatttggtgt ctgtaagtat caaccatttc
    11461 ttgatcaaga taaggaagca acactgatac tgagagagag gtcatatgtc caatagttgc
    11521 ctttcttctc ttaggcagct ctgcacttca tgttcagttt tttaaaaata gactgtagta
    11581 tcctttcatt ggagaattta caaaaatatc atctacagct caaaagtccc actaacggct
    11641 tatatgaaca gaaagtactg tgtagcccag gagtttattt agcaagataa atagtggtaa
    11701 tttcttaatc attccccttt cctttgcttt accttctggc agatgcttag ctacttcttt
    11761 ggctacctca taatttgtat gggaatgaac atgaattagg gaacttcaaa tagtgcgtag
    11821 acttttccct acttaccatt gggttcaatt gatgtagact gttagagcaa gtatactcaa
    11881 tcaacttgct gatattttag tagttaacag cttccgagcc tatcatgcaa tttggagtct
    11941 gtcaatgaat atagcaatcg gtgaagcatt actgtacgaa gtctgttttc aggctttggg
    12001 tcaagctggt tttataccaa atttcactct acaatgcata ttctaatgaa gctactttat
    12061 ataaattgga gagcttataa aatgcagaac atttctatcc tatcctacca aatatttatc
    12121 cttctctgtc ctctattctc ttactctcct ctctcccttt ttccttccct ttattccctt
    12181 gaaaaaagag aatctgtggg aaataggcag atatagcttt ttaaaatata aagtacttgg
    12241 gattttgcat tatttttctt aatatctatt tactaagtat gtaatttaat atacattaat
    12301 tattttttga aactcttgtt agtgggaaga atatggtaaa ttttttgtta aataaaatag
    12361 acccttatgt ttagcatttt gtttttagag aactattctg gtactatcag aacaaataca
    12421 taaaataact tcccatagag aacaggatat agcaataata gctccttaga tactcagtgg
    12481 cttctgactc caatcaaggt cttgttgata ttatatagta aaaataaaac caaaaataaa
    12541 tattattcaa gtggctcttc taagcatgtg aatcatgaag cactgaaata tgtattttaa
    12601 tgatgatctt atttattccc atttttgccc ttagttaaca tttactggtg ctcacctagg
    12661 attggctatt ctgagggatt gcatagaaac caagctccac ttgctgtcct tgggaaggtt
    12721 ataactgaat gcagctcttt atttggacta aagtgtcagg atatgcatta gattctctcc
    12781 tgaaccaaaa acacaacagt cattatctgt gaaccataat ttaaaaatct ttctagaata
    12841 acaacagcag actccactct tgtttgtcta aaagagccct actgggtatg gatcattctg
    12901 atgacagatt tatacaaaat gattcaaacc agtaacttag taaaattgac cttcgcaaaa
    12961 cctcactggg ggagtgcctt gtagagctgt gggtgggact gcacattctt ttcctcttag
    13021 taaaagatag gcccacttta ttccaagaat aacacttagc acataaactc ttcttccagc
    13081 tcgttagcag cattagcacc ttctgaattc caccctctca gaagaatcca cagtgtttga
    13141 acaatttgca taaaggtcag ctagcatcct gctgccaagc cactgcatag catttgtgat
    13201 aagaaggacc aactctaggc tcaatatgaa gggatttagt tctgtaagca gcaaaaaagc
    13261 ttctttatca agtcatctta cctctaattc ttttccagtg tgccaactcc aaagtcaaca
    13321 ttaaaaatgt aaatggacct gtgtaaatat cacagagagc ttttccttat acatctcaat
    13381 gctgagagtt aaaatattcc caggttaaaa tttttttaaa gtaccaataa tagagctaaa
    13441 tacaatgaca tttgctttta aaaggtggat attttatttc tgctttttga aaatacttat
    13501 ttagtattga cttggaagcc aatttggtcc tttaataagt aaagaaaata atatgtttaa
    13561 aaatgtaaat gttttacaaa tttgaaactt tcataattgt attaatcaga aaacaagcac
    13621 attgccattc tttgaaactc atgtttctag acatgacagc agtaataaaa ggatgaaaac
    13681 aagtgtcttc actaagcgta tggccaataa atgggaccca aacgttcaat ctgttcagtt
    13741 taccaaggtt cagaaatacg taatttagca ggaaactata aataccagtg ctatcacagc
    13801 cacacataca cacacacaga cataaaataa ccaaacatct catttctagg aaagagataa
    13861 cactaaaggc atcataggtt taactgaaat acgttatatg aagttttaca aaaaggtcaa
    13921 cagaaagctc atttgtgaaa acatactctc atgggagctt ctttaacatt agttcagagg
    13981 ttaatatatt tcctggaggt gttttcctag aattgattgc actattgcat ggtaataaca
    14041 tttaattgtt aaggaaacat tatatatagg ttcaaattat cccttaatgt tgatttctcc
    14101 ccttttccat ggattttgat actaagaaac aaaatgcttt gagattttgg taactatttt
    14161 gattttgata aaacatgtta aaatagaagg acatgatatt tttctatagt ttccatcagg
    14221 aagagtacat cagaaacttc tccataagga aagaaaactg actctctctt gaactagtgt
    14281 tgacaaaata cactaatgtc tttcttaatt ttattttatt aggagaaaaa tcagaatatt
    14341 aaatttgcaa acttttgaac agcagtaata gctccttaga cactcagtat ctttcttccc
    14401 tatctttcaa gcacatttaa tttctttccc ctggtatttg tttgctttgt gttttttcaa
    14461 tattttgttt gctaaagaac aataacaaca acaaagctgg tccagccctg acacctactt
    14521 ttgctttttt tctttctttc ttttaatttg ttgaactata ggtttctttc tgagatgtat
    14581 ttttcattct tccaataatg ctctcttttt catttcaaaa ccattaccac tttcaatatg
    14641 taattaacat cctcattcat cagaaagctg gtaagtccac acagcatttg tgcagtatcc
    14701 cttctgtgta aaatgttaag gctttcagat gaaagaaaaa agaacttcct gcaaaagatc
    14761 aaaagcatca tactaaataa aatgatgaca atatgtgcct tgatttttct ctcaatggag
    14821 gttcaacatt gacatttaag atgtaaaaaa aattactttg atggtttaat taagaataat
    14881 aagtcaaata tcacatgtat gtagttcttt tggatgaccg aataccttaa aatgaactaa
    14941 ataactgaaa taaagtgtta aaatgttaac agcgttgaag tttttaaaat tataattatc
    15001 aaatgcacaa tgttctttta ctatgccaaa tgttgcctac actgattaca tgattgtcac
    15061 agtttaagtg aatttctact atggatcttt attttcccca atgtttggat catcctctca
    15121 gataagaatt gtcagtattg cacctcaaga aagaagaaaa aataagaatg taaattttta
    15181 aaagctagca ttaaaagtaa agagcagtac aataaaaatc acttaaaata gagaaaggca
    15241 actactgagt aagaagaaaa gataatttct gtaaaagcta aatttatgca cattacaaaa
    15301 agtagtcaag tcagtcttcc attgtgactt caggaattca aatgcaagtt gttggcaaaa
    15361 tatatatata cacacacaca cacatacaca cacatatatg tacatacata tatatataga
    15421 gagagagaga tagatttttt ttttttgaga cagagtttcg ctcttgttgc ccaggctgga
    15481 gtgcaatgga atgatcttgg ctcaccgcaa cctccgcctc cagggttcaa gtgattctcc
    15541 tgcctcaacc tcctgagtag ctggaattac aggtgcccac taccatgcct ggctagtttt
    15601 tgtattttta gtagagacag ggtttctcca tgttggtcag gctgatctcg aactcccaac
    15661 ctcagatgat cctcccgcct ccacctccca aagtactgga attacaatgg cgtgagccac
    15721 cacaagatat ttttaaagcc catttgtcta taaaagaaaa ctcttggaca aggagctttg
    15781 tgttttataa ttgtattacg tgcctgcttc cttaccaagt gccctccata acactaagta
    15841 aatttatatt tatctagcct ctgagtgaca tatctgtgtg taatggaatt atttgcagaa
    15901 tttaatagcc ttttttattt tcgcatgaga atttttcaaa aactatcagg gtctagtttt
    15961 atcatacatt tactaagtta ctacatattg gtggatattg acgtttattc ctgggaatct
    16021 aattttgcaa acaatttgga gccattcagt cataaattca tgtcaacaat aagtcttgct
    16081 gccgcttgtg tttcataact acgcttgctt tccttcaaaa tataccaagt gtgtaatata
    16141 aataaagccc atatcaatat aaaaaaaaaa aaaaaaaaa
//

Композиционный код:

1,1,2,1,4,3,1,4,3,1,4,1,4,2,1,1,1,1,1,3,3,2,2,4,2,4,4,1,4,4,4,4,4,4,4,3,1,4,2,4,2,1,1,1,4,2,1,1,3,1,
1,1,1,4,1,4,1,3,3,1,4,4,3,2,4,1,3,3,1,1,1,2,4,4,4,1,1,2,1,4,4,3,1,1,3,3,1,1,4,3,1,4,3,1,4,4,1,1,4,1,
1,4,1,1,1,4,3,4,2,2,1,1,1,2,4,1,1,2,4,1,1,4,3,1,1,1,1,4,1,1,3,1,3,1,1,4,1,1,3,1,4,1,4,1,1,4,3,4,1,1,
1,4,4,1,4,1,3,1,4,1,2,4,2,2,4,2,2,4,2,4,1,4,1,4,1,1,1,1,4,1,3,4,3,4,1,1,3,4,1,4,3,1,4,4,4,1,1,3,1,4,
1,4,4,1,4,1,1,1,1,1,1,1,2,1,1,1,1,4,1,1,4,1,1,1,1,4,4,3,1,3,2,3,1,1,1,1,4,1,1,3,2,2,1,3,1,2,1,1,4,1,
3,1,4,1,1,1,3,3,1,1,3,2,1,4,1,3,1,1,2,1,1,3,1,2,2,1,1,1,1,2,1,1,4,4,1,4,3,2,2,4,3,3,4,1,1,3,3,1,3,1,
1,1,1,1,3,4,4,1,1,2,2,4,1,1,1,3,2,1,1,1,3,1,4,1,1,1,1,1,1,4,1,1,3,2,4,4,1,4,1,2,1,1,4,2,1,1,3,3,1,3,
1,3,1,4,1,1,1,1,3,3,3,2,1,1,3,1,1,1,1,1,4,1,1,3,3,1,1,4,1,3,1,1,1,3,1,1,3,4,4,1,4,1,3,1,1,1,1,3,3,3,
1,3,1,1,1,1,1,3,3,4,3,1,1,2,4,3,2,3,2,2,3,2,1,3,3,1,1,1,2,4,4,1,1,1,1,2,1,3,4,4,1,1,4,3,1,3,3,3,1,3,
1,3,1,3,4,1,1,2,1,3,2,1,3,3,4,3,1,1,1,1,1,3,1,3,1,2,3,2,4,4,2,1,4,4,3,4,1,4,3,3,1,3,1,3,4,3,3,1,3,1,
1,3,3,1,1,1,3,2,4,3,1,4,2,1,1,1,4,1,1,1,3,3,1,3,1,1,4,4,1,1,1,4,4,3,1,1,4,3,2,2,1,1,1,1,2,1,3,4,1,1,
1,1,3,4,3,4,3,1,1,2,3,3,1,3,1,1,4,4,4,2,4,2,1,3,3,2,4,1,1,4,1,3,1,4,3,2,3,1,1,3,2,3,3,3,4,4,3,3,4,4,
1,2,1,1,3,3,4,4,3,4,3,1,1,3,3,1,3,1,3,1,1,1,3,3,1,3,1,3,1,1,1,1,4,2,3,3,1,2,2,4,2,1,1,1,1,1,1,2,2,1,
1,1,4,1,3,3,1,3,4,1,3,3,3,4,2,1,2,1,1,1,2,3,3,1,1,3,1,3,1,3,3,3,1,1,4,2,1,4,3,4,3,3,1,3,3,4,3,1,1,3,
4,1,4,1,3,1,3,1,3,3,1,4,2,1,3,1,1,1,2,2,4,1,1,1,1,4,1,1,3,1,4,1,2,3,1,2,3,2,3,1,2,4,3,1,1,1,2,1,2,1,
3,3,1,4,2,1,2,4,3,1,1,1,1,3,1,1,1,2,1,4,4,1,3,3,1,3,1,1,1,1,3,3,3,3,3,1,3,1,4,3,3,3,4,1,4,3,3,2,4,1,
1,1,1,1,1,4,3,1,2,3,4,3,4,3,2,3,1,3,1,3,1,1,3,1,4,1,1,1,2,3,1,1,1,1,1,1,1,3,3,1,1,1,3,1,1,1,4,3,1,2,
1,1,1,4,3,3,2,1,3,3,3,1,3,1,3,1,3,1,3,1,2,1,3,3,1,1,1,3,4,3,2,1,1,4,3,2,4,3,1,1,1,1,1,1,2,3,1,1,2,3,
1,3,1,3,3,4,1,1,1,4,3,3,1,1,1,1,3,1,3,1,3,3,3,4,4,1,1,3,1,3,2,3,1,4,2,4,3,3,3,4,1,2,4,1,3,3,3,1,3,4,
1,1,3,2,3,1,3,3,3,4,3,3,3,1,3,1,3,3,3,1,4,1,3,1,3,3,3,1,1,1,1,3,1,1,1,3,3,2,3,1,3,4,3,1,1,1,3,1,3,2,
2,1,1,3,3,3,1,1,1,1,1,1,3,3,2,3,1,1,1,3,3,1,2,1,2,1,3,3,4,3,3,3,1,4,3,4,2,3,1,3,3,3,1,3,3,3,1,3,3,1,
3,2,3,3,2,1,4,1,1,4,3,3,3,1,1,1,2,3,1,3,2,3,3,1,1,2,2,1,3,3,3,3,3,3,2,2,2,4,3,2,3,3,3,3,1,1,1,4,3,3,
1,1,1,1,3,2,3,3,1,3,3,2,3,3,3,3,1,3,3,2,2,2,1,3,1,3,2,3,2,4,3,1,2,3,3,1,1,1,3,3,1,1,1,1,1,2,1,3,1,1,
3,1,3,3,4,4,3,3,4,1,1,2,3,2,3,3,3,3,3,1,3,1,3,2,1,3,1,1,1,1,3,2,1,3,1,1,3,3,3,1,2,1,1,3,1,3,3,3,1,4,
1,3,1,1,3,4,2,3,3,2,1,3,1,3,3,3,3,3,3,3,1,4,3,3,3,3,1,3,3,1,3,1,1,3,3,3,1,1,1,3,1,4,2,3,1,4,3,1,1,3,
1,1,1,1,3,1,1,2,1,3,1,1,3,3,3,1,3,3,1,1,1,1,1,3,1,3,3,4,3,3,2,2,3,4,1,1,3,4,3,1,4,1,1,3,2,3,1,3,3,3,
3,1,4,1,3,1,3,1,3,3,2,2,3,2,3,3,4,3,1,1,3,1,1,1,3,2,3,1,2,2,3,3,3,2,3,1,3,3,1,3,3,3,3,3,3,4,2,2,3,1,
3,3,1,3,2,3,3,3,3,1,3,3,3,1,2,4,1,1,3,3,1,1,3,3,2,1,3,1,3,3,1,3,1,3,1,4,3,1,1,3,4,1,2,3,3,3,3,4,3,3,
2,2,3,1,1,2,3,3,1,3,3,4,1,1,4,1,3,1,3,1,1,3,3,4,2,3,1,2,4,1,1,3,3,3,1,3,1,3,3,2,2,1,2,2,1,3,3,1,1,1,
3,3,3,3,1,1,3,3,1,1,1,1,3,1,1,2,3,1,4,3,1,4,3,1,3,3,4,1,1,4,3,1,3,1,4,3,4,3,2,1,3,1,1,1,1,1,2,3,3,3,
3,4,3,1,1,3,3,1,3,3,1,1,3,2,3,1,3,1,3,4,2,1,3,1,1,3,1,3,4,1,3,3,1,2,4,1,1,1,1,1,4,3,1,3,3,3,3,1,1,4,
3,3,3,3,1,1,3,1,3,1,3,3,3,3,1,1,1,4,3,1,3,1,1,1,4,3,3,3,1,3,1,2,1,1,3,1,3,3,1,1,3,3,1,1,3,1,1,3,3,1,
3,1,1,1,3,3,3,1,3,1,2,3,3,3,1,1,1,1,2,4,3,3,1,1,3,2,1,1,3,3,3,3,3,4,4,3,3,2,1,3,1,3,4,1,1,1,1,1,1,3,
3,1,1,3,1,1,3,1,2,4,3,1,4,1,3,2,3,1,3,2,1,3,1,1,1,4,1,1,1,2,1,3,2,1,3,4,1,1,3,1,1,3,1,3,3,3,3,3,1,4,
2,1,1,3,3,3,2,3,3,1,1,4,1,3,1,1,1,1,1,3,1,1,2,3,3,1,3,3,1,1,3,2,1,3,1,3,3,3,4,3,3,1,2,3,3,1,1,3,3,2,
3,3,3,3,3,2,1,1,3,4,1,1,3,3,3,4,3,1,2,1,1,1,3,3,1,3,3,1,4,1,3,1,1,1,3,3,2,3,3,3,3,3,3,3,3,1,1,2,3,3,
3,3,2,3,3,1,2,3,1,3,3,2,3,3,1,3,1,1,1,1,3,2,1,3,3,4,1,1,1,2,1,1,1,1,1,2,1,2,4,4,1,4,3,3,4,1,3,1,1,3,
3,1,3,1,4,2,1,2,1,1,4,4,3,1,1,3,1,1,2,1,1,3,3,1,1,3,3,2,2,3,1,2,3,4,3,3,1,1,1,3,1,1,3,3,3,3,3,3,1,4,
1,3,1,1,1,1,1,2,3,4,1,1,1,1,1,4,1,3,3,1,3,3,2,2,2,3,2,3,4,4,3,1,4,1,3,1,3,3,1,2,1,1,3,1,1,1,1,3,3,1,
1,3,1,3,3,3,4,1,3,4,3,4,2,1,2,3,3,1,3,1,1,1,1,1,3,1,1,3,1,3,4,1,1,1,1,4,2,3,1,2,2,1,1,2,4,3,3,3,2,1,
3,3,1,3,3,3,3,1,1,3,1,1,3,3,4,3,1,3,4,3,1,3,3,1,3,4,3,4,1,4,1,3,4,1,3,1,4,1,1,3,3,3,1,2,4,1,3,4,3,2,
3,3,1,3,2,3,3,2,2,1,3,4,1,1,1,3,3,3,3,3,2,3,2,1,1,1,1,3,3,3,3,1,3,4,3,1,3,2,3,2,4,4,1,2,3,1,3,3,3,4,
4,3,1,1,3,1,1,2,1,3,1,1,1,1,3,1,2,4,1,2,3,1,3,1,1,3,1,3,1,1,3,1,3,3,2,2,3,3,1,1,3,3,3,4,1,2,3,2,1,1,
3,1,3,4,3,1,1,1,3,3,2,4,3,1,1,1,4,1,4,3,2,1,4,1,1,1,3,3,3,1,2,1,3,3,1,1,1,1,2,1,1,3,3,1,2,3,1,1,1,3,
3,1,4,1,1,3,4,1,3,1,1,2,1,1,1,1,4,2,1,1,3,2,3,1,1,3,1,3,4,3,2,3,3,3,3,3,3,3,1,2,1,1,2,3,3,3,3,1,3,3,
3,3,3,2,3,1,3,3,3,1,3,3,1,3,3,3,2,1,4,4,3,2,3,3,2,4,3,1,3,2,1,3,2,1,3,1,3,4,3,1,1,1,1,3,1,4,1,1,3,2,
3,1,1,1,3,4,2,3,3,3,1,3,1,3,4,3,1,1,1,4,3,3,1,3,3,1,3,1,4,4,3,1,1,3,1,1,1,3,3,1,2,3,3,3,3,3,1,2,2,1,
1,1,1,4,3,1,3,4,1,2,3,3,1,1,1,1,2,3,1,3,3,3,3,1,3,3,3,2,1,4,1,1,3,1,1,3,1,3,3,1,1,3,3,3,1,1,3,1,3,3,
1,1,3,1,2,3,1,1,1,3,3,2,1,1,3,3,2,1,3,1,3,2,3,1,1,1,3,1,3,1,4,4,1,4,1,4,3,3,2,3,4,1,3,1,3,4,1,1,3,1,
3,3,4,1,1,1,1,3,3,4,2,1,1,1,1,2,4,1,1,2,1,3,1,3,1,1,4,2,1,1,2,3,3,3,4,1,1,3,4,3,3,1,4,1,1,1,1,3,3,2,
1,1,1,3,3,3,3,3,3,1,1,3,2,3,4,3,3,2,2,1,4,1,2,3,3,1,1,1,2,1,3,1,3,2,1,1,2,1,3,1,1,1,3,1,2,1,2,1,2,3,
1,1,1,1,4,1,1,3,3,1,3,1,1,3,1,1,1,1,1,3,3,1,2,3,3,2,1,1,1,1,1,1,1,4,3,3,3,3,4,1,3,3,3,3,1,1,3,3,3,1,
3,3,2,3,2,3,2,1,2,3,3,1,1,1,1,1,1,1,3,3,1,3,1,1,1,1,1,4,1,4,1,2,1,1,3,3,1,1,1,3,1,1,3,1,1,2,3,1,3,3,
1,3,3,1,1,3,2,2,3,2,1,1,2,1,2,4,1,1,3,4,1,3,2,1,3,4,3,3,1,1,4,1,3,1,1,4,4,2,2,1,1,1,3,3,1,1,1,2,1,3,
3,2,3,3,4,1,1,1,1,1,1,1,3,3,2,3,1,1,1,2,1,3,3,3,3,3,3,1,3,2,1,1,1,1,1,3,3,1,4,1,1,1,4,1,1,1,2,1,3,1,
1,3,1,3,3,4,4,2,3,1,2,1,3,2,1,2,4,1,1,2,3,3,3,2,1,4,2,3,1,1,1,1,2,1,3,3,2,1,3,1,1,2,2,1,1,1,1,3,1,3,
1,3,1,2,3,1,1,2,4,1,3,3,4,1,4,4,2,1,3,1,2,2,3,1,3,1,1,4,2,1,1,1,1,1,3,3,3,1,1,3,1,3,1,1,2,1,3,1,1,3,
3,2,4,3,3,1,3,1,1,1,1,3,1,1,4,1,3,1,1,3,1,1,1,3,3,2,1,1,2,1,4,3,1,3,3,3,3,3,2,3,3,3,2,3,3,3,3,1,1,4,
3,3,1,1,3,4,3,1,1,3,1,1,1,3,1,1,4,3,2,1,3,2,3,3,1,3,3,1,1,3,3,2,1,3,2,3,3,1,1,3,1,1,3,3,2,1,3,3,3,3,
3,3,4,1,3,3,1,2,1,2,3,4,1,3,3,2,3,1,2,3,3,1,3,2,2,4,3,1,3,3,1,3,1,3,4,3,1,3,2,3,3,2,3,3,1,1,2,2,2,1,
3,1,1,3,2,1,2,3,1,3,2,3,4,1,3,2,4,3,4,3,1,3,1,3,2,3,3,1,3,3,3,4,1,1,3,3,4,4,3,3,2,1,1,3,1,1,1,1,1,4,
1,1,3,1,1,1,1,2,1,2,4,2,1,1,3,3,3,3,1,3,2,2,2,1,1,1,1,3,1,4,1,1,1,1,1,1,1,1,3,4,3,2,3,2,3,1,1,1,1,1,
1,1,1,1,1,1,3,2,1,1,4,1,3,4,4,2,1,1,4,2,4,3,1,1,1,1,1,3,1,3,2,4,4,1,1,1,1,1,3,3,1,1,4,1,3,1,4,3,1,1,
1,1,3,1,1,1,4,1,2,1,1,3,1,3,1,1,2,3,

Вторичная структура (Пикотех): https://img-fotki.yandex.ru/get/195419/ … 7_orig.gif

https://img-fotki.yandex.ru/get/197923/158289418.3c0/0_170309_568c6c0_orig.png
Здесь мы видим не 100%-ную корреляцию первичной и вторичной структур белковой молекулы.

https://img-fotki.yandex.ru/get/197852/158289418.3c0/0_17030a_9e5eba1e_orig.png
Любопытная программная спираль: 212212212. Интересно смоделировать эту структему в 3D.

https://img-fotki.yandex.ru/get/114207/158289418.3c0/0_17030b_51c52872_orig.png
Здесь корреляция первичной и вторичной структур белка видна даже на уровне алгоритма Виктории smile

https://img-fotki.yandex.ru/get/171750/158289418.3c0/0_17030d_c1294fc5_orig.png
Не 100%-ная корреляция - тоже корреляция однако...

https://img-fotki.yandex.ru/get/198361/158289418.3c0/0_17030c_984657f1_orig.png
Не 100%-ная корреляция - тоже корреляция...

https://img-fotki.yandex.ru/get/114207/158289418.3c0/0_17030e_840f5637_orig.png
Не 100%-ная корреляция - тоже корреляция...

https://img-fotki.yandex.ru/get/30894/158289418.3c0/0_17030f_720b5650_orig.png
Не 100%-ная корреляция - тоже корреляция...

https://img-fotki.yandex.ru/get/197923/158289418.3c0/0_170310_50b10a42_orig.png
Не 100%-ная корреляция - тоже корреляция...

https://img-fotki.yandex.ru/get/98813/158289418.3c0/0_170311_330d22f5_orig.png
Здесь корреляция первичной и вторичной структур белка видна даже на уровне алгоритма Виктории smile