1

Тема: Антинаправленные лизиновые альфа-спирали

Пикотехнология белков, ДНК, РНК - 2

Антинаправленные лизиновые альфа-спирали

http://nanoworld.org.ru/topic/1544/page/32/

https://blast.ncbi.nlm.nih.gov/Blast.cgi

https://img-fotki.yandex.ru/get/198998/158289418.3bd/0_170106_401428a9_XL.png

https://img-fotki.yandex.ru/get/42692/158289418.3bd/0_170107_4acb8939_XL.png

https://www.ncbi.nlm.nih.gov/protein/53 … C0A790J015

PREDICTED: pre-mRNA-splicing factor SLU7 isoform X1 [Homo sapiens]
NCBI Reference Sequence: XP_005265850.1
Identical Proteins FASTA Graphics
Go to:
LOCUS       XP_005265850             596 aa            linear   PRI 06-JUN-2016
DEFINITION  PREDICTED: pre-mRNA-splicing factor SLU7 isoform X1 [Homo sapiens].
ACCESSION   XP_005265850
VERSION     XP_005265850.1
DBLINK      BioProject: PRJNA168
DBSOURCE    REFSEQ: accession XM_005265793.3
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_000005.10) annotated using gene prediction method: Gnomon,
            supported by mRNA and EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
           
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Homo sapiens Annotation Release 108
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..596
                     /organism="Homo sapiens"
                     /db_xref="taxon:9606"
                     /chromosome="5"
     Protein         1..596
                     /product="pre-mRNA-splicing factor SLU7 isoform X1"
                     /calculated_mol_wt=69273
     Region          171..444
                     /region_name="Slu7"
                     /note="Pre-mRNA splicing Prp18-interacting factor;
                     pfam11708"
                     /db_xref="CDD:288545"
     CDS             1..596
                     /gene="SLU7"
                     /gene_synonym="9G8; hSlu7"
                     /coded_by="XM_005265793.3:473..2263"
                     /db_xref="GeneID:10569"
                     /db_xref="HGNC:HGNC:16939"
                     /db_xref="HPRD:12074"
                     /db_xref="MIM:605974"
ORIGIN     
        1 mktsiggqit msatvvdavn aaplsgskem sleepkkmtr edwrkkkele eqrklgnapa
       61 evdeegkdin phipqyissv pwyidpskrp tlkhqrpqpe kqkqfsssge wykrgvkens
      121 iitkyrkgac encgamthkk kdcferprrv gakftgtnia pdehvqpqlm fdydgkrdrw
      181 ngynpeehmk iveeyakvdl akrtlkaqkl qeelasgklv eqanspkhqw geeepnsqme
      241 kdhnsedede dkyaddidmp gqnfdskrri tvrnlrired iakylrnldp nsayydpktr
      301 amrenpyana gknpdevsya gdnfvrytgd tismaqtqlf aweaydkgse vhlqadptkl
      361 ellyksfkvk kedfkeqqke silekyggqe hldappaell laqtedyvey srhgtvikgq
      421 eravacskye edvkihnhth iwgsywkegr wgykcchsff kysyctgeag keivnseeci
      481 ineitgeesv kkpqtlmelh qeklkeekkk kkkkkkkhrk sssdsddeek kheklkkaln
      541 aeearllhvk etmqiderkr pynsmyetre pteeemeayr mkrqrpddpm asflgq
//

Кушелев: Ну вот, наконец начинает проясняться...

ORIGIN     
        1 mktsiggqit msatvvdavn aaplsgskem sleepkkmtr edwrkkkele eqrklgnapa
       61 evdeegkdin phipqyissv pwyidpskrp tlkhqrpqpe kqkqfsssge wykrgvkens
      121 iitkyrkgac encgamthkk kdcferprrv gakftgtnia pdehvqpqlm fdydgkrdrw
      181 ngynpeehmk iveeyakvdl akrtlkaqkl qeelasgklv eqanspkhqw geeepnsqme
      241 kdhnsedede dkyaddidmp gqnfdskrri tvrnlrired iakylrnldp nsayydpktr
      301 amrenpyana gknpdevsya gdnfvrytgd tismaqtqlf aweaydkgse vhlqadptkl
      361 ellyksfkvk kedfkeqqke silekyggqe hldappaell laqtedyvey srhgtvikgq
      421 eravacskye edvkihnhth iwgsywkegr wgykcchsff kysyctgeag keivnseeci
      481 ineitgeesv kkpqtlmelh qeklkeekkk kkkkkkkhrk sssdsddeek kheklkkaln
      541 aeearllhvk etmqiderkr pynsmyetre pteeemeayr mkrqrpddpm asflgq
//

https://www.ncbi.nlm.nih.gov/nuccore/1034643291

PREDICTED: Homo sapiens SLU7 homolog, splicing factor (SLU7), transcript variant X1, mRNA
NCBI Reference Sequence: XM_005265793.3
FASTA Graphics
Go to:
LOCUS       XM_005265793            3907 bp    mRNA    linear   PRI 06-JUN-2016
DEFINITION  PREDICTED: Homo sapiens SLU7 homolog, splicing factor (SLU7),
            transcript variant X1, mRNA.
ACCESSION   XM_005265793
VERSION     XM_005265793.3
DBLINK      BioProject: PRJNA168
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_000005.10) annotated using gene prediction method: Gnomon,
            supported by mRNA and EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
           
            On Jun 6, 2016 this sequence version replaced gi:767938029.
           
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Homo sapiens Annotation Release 108
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..3907
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="5"
     gene            1..3907
                     /gene="SLU7"
                     /gene_synonym="9G8; hSlu7"
                     /note="SLU7 homolog, splicing factor; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     mRNAs, 87 ESTs, 681 long SRA reads, 10 Proteins, and 95%
                     coverage of the annotated genomic feature by RNAseq
                     alignments, including 104 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:10569"
                     /db_xref="HGNC:HGNC:16939"
                     /db_xref="HPRD:12074"
                     /db_xref="MIM:605974"
     CDS             473..2263
                     /gene="SLU7"
                     /gene_synonym="9G8; hSlu7"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor SLU7 isoform X1"
                     /protein_id="XP_005265850.1"
                     /db_xref="GeneID:10569"
                     /db_xref="HGNC:HGNC:16939"
                     /db_xref="HPRD:12074"
                     /db_xref="MIM:605974"
                     /translation="MKTSIGGQITMSATVVDAVNAAPLSGSKEMSLEEPKKMTREDWR
                     KKKELEEQRKLGNAPAEVDEEGKDINPHIPQYISSVPWYIDPSKRPTLKHQRPQPEKQ
                     KQFSSSGEWYKRGVKENSIITKYRKGACENCGAMTHKKKDCFERPRRVGAKFTGTNIA
                     PDEHVQPQLMFDYDGKRDRWNGYNPEEHMKIVEEYAKVDLAKRTLKAQKLQEELASGK
                     LVEQANSPKHQWGEEEPNSQMEKDHNSEDEDEDKYADDIDMPGQNFDSKRRITVRNLR
                     IREDIAKYLRNLDPNSAYYDPKTRAMRENPYANAGKNPDEVSYAGDNFVRYTGDTISM
                     AQTQLFAWEAYDKGSEVHLQADPTKLELLYKSFKVKKEDFKEQQKESILEKYGGQEHL
                     DAPPAELLLAQTEDYVEYSRHGTVIKGQERAVACSKYEEDVKIHNHTHIWGSYWKEGR
                     WGYKCCHSFFKYSYCTGEAGKEIVNSEECIINEITGEESVKKPQTLMELHQEKLKEEK
                     KKKKKKKKKHRKSSSDSDDEEKKHEKLKKALNAEEARLLHVKETMQIDERKRPYNSMY
                     ETREPTEEEMEAYRMKRQRPDDPMASFLGQ"
ORIGIN     
        1 attacgagat tggcttggat tctgtcggat ggacttgggg ctagctgcgg cggggctggg
       61 taagaaaata ttgttagaac ttgcgggcga cggggagttg gggaacctga gaaaatgagt
      121 cgaaggctcc taattattgg atatatcttc acgggggtga tgagccctca ggtgttgagg
      181 gagcgaggac gggggaccga aaagccactg tcctgagacc cattcatggc actcgtgccc
      241 tgccaggcca ggcctgcgtc ttcagggaaa cagtcgggat aactatgaga gtgtcgcctt
      301 tgtggcggtg cctcgaagac cttgagcaat ccccggactg cgagcaggga aagctgcttc
      361 cagtacccaa attgacagac tgtatttcct cgccagaaaa atttacttga gcttcagttt
      421 ttcctgttaa gtcgagatga tccgacttca gtggggtatc atgcgggtat aaatgaaaac
      481 atctatagga ggccagataa ccatgtcagc cacagttgta gatgcagtta atgctgcacc
      541 cctatcgggg tccaaagaaa tgagtttgga agaaccaaag aagatgacca gagaggactg
      601 gagaaagaag aaggagctag aagaacagcg aaaattgggc aatgctcctg cagaagttga
      661 tgaagaagga aaagacatca acccccatat tcctcagtat atttcttcag tgccatggta
      721 tattgatcct tcaaaaagac ctactttaaa acaccagaga ccacaaccag aaaaacaaaa
      781 gcagttcagc tcatctggag aatggtacaa gaggggtgta aaagagaatt ccataattac
      841 taagtaccgc aaaggagcat gtgaaaattg tggggccatg acacacaaaa agaaagactg
      901 ctttgagaga cctaggcgag ttggagccaa atttacaggt actaatatag ctccagatga
      961 acatgtccag cctcaactga tgtttgacta tgatgggaag agggatcggt ggaatggcta
     1021 caatccagaa gaacacatga aaattgttga agagtatgcc aaagttgatt tggcaaaacg
     1081 aacattgaaa gcccagaaac tccaagagga attagcctca ggaaaattag tggaacaggc
     1141 taattctcca aaacaccagt ggggagaaga ggaaccaaat tctcagatgg aaaaagatca
     1201 taatagtgaa gatgaggatg aagataaata tgcagatgat attgacatgc ctggacagaa
     1261 ttttgactcc aagagacgaa ttactgtccg gaatctcagg attcgagaag atattgcaaa
     1321 atatttgagg aatttagatc caaattctgc ctactatgat ccaaaaacta gagcaatgag
     1381 agagaatcct tatgccaatg caggaaagaa tccagatgaa gtgagttatg ctggagataa
     1441 ctttgttagg tacacaggag ataccatttc aatggctcag acacagttgt ttgcatggga
     1501 agcctatgac aagggatctg aagtgcatct acaggcagat cctacaaagc tagagctgtt
     1561 gtataagtcc ttcaaagtca aaaaagaaga tttcaaagaa cagcagaaag aaagcatcct
     1621 ggaaaagtat ggtggccaag aacatttgga tgcccctcca gctgaattgc ttttagccca
     1681 gactgaagac tatgtggagt actcaagaca tgggacagtc atcaaaggac aggagcgggc
     1741 tgttgcctgc tctaagtatg aggaggatgt gaagatccac aatcacacac atatctgggg
     1801 atcgtactgg aaagaaggcc gatggggata caaatgctgt cactcttttt tcaagtattc
     1861 ctattgtact ggagaagctg ggaaggagat tgttaactct gaggagtgta ttataaatga
     1921 gataactggg gaagaatctg tgaaaaaacc tcaaaccctc atggagctgc atcaagaaaa
     1981 actgaaagag gaaaagaaga agaagaaaaa gaaaaagaag aagcatcgaa agagcagttc
     2041 agatagtgat gatgaagaaa agaagcatga aaaattgaaa aaggcactga acgcagagga
     2101 ggcccgcctt cttcatgtca aggagaccat gcagattgat gagaggaagc ggccttacaa
     2161 tagcatgtat gaaactcgag aacctactga agaggaaatg gaggcatata gaatgaaacg
     2221 tcagaggcca gatgacccca tggcctcttt ccttggacag tagcaactag tcagaagacc
     2281 atccaagata gatgcagctg atacattctt ttcagcttct tattgatgat tgtagataga
     2341 aaaatccttg tttattcttc ttgctgcctg gctttaataa atatttcaga tgcctcacag
     2401 taagttcact cctttccata ctgaggaaac aagaaaagaa gaagaggcac atgaagtgtg
     2461 cttttgggaa tagaatttaa aattggatta agattttatt tccagttttt tttatttatt
     2521 tatttttttt tttgagacgg agtcttgctc tgtcgcccag gctgaagtgc ggtggcgcga
     2581 tctcggctca ctgcaagctc cacctcccag gttcacgcca ttctcctgcc tcagcctccc
     2641 tagtagttgg gactacaggc gcccgccacc atgctcagct aattttttgt atttttagta
     2701 gagacggttt catcgtgtta gccaggatgg tctcgatctc ctgaccttgt gatccacccg
     2761 cctcagcctc ccaaagtgct gagattacag gcgtgagcca ccgcgcctgg cctatttcca
     2821 gttttatgtg agtcatgtaa aaaagccttg gctctctacc tattaagaat gtctctttct
     2881 ctgtatttat taagcttcaa actttattgc ttcgattttt gtggccctat atttagtatt
     2941 agcacacctt ggttttgaga aaaaaacagg gctttgtttt tttaaataat tactagcaac
     3001 tctgtgacta catttatttt tatttttttt agagacagga tcttgctatg ttgcccaggc
     3061 tagagagcag tggcttttca cagacaaagt cataatgccc tgcagtcttg ggctcaagcg
     3121 attctctctt ccttggcctc tggagtagac taaatgtgtt agtctttgaa tggaaaacaa
     3181 ctattttctc atcattgggt caatattgac tgatcagtag taggtctttt accattctgg
     3241 acataagtct aggtgtagaa atcctttcct ttatcataga ggatatggtt tacattaccg
     3301 tttgttttca ttgtgattgc ccctatgtaa caatcatgaa tattagattt tttaaattgt
     3361 agaatatcct aatatttata gccagcagct gttactttgt ttgtaaaatt tgcaaaaaaa
     3421 caaaacctga agttggttta ttgaaagaat tataaggata gcttctaggg atattagtaa
     3481 tagattgcca tgatcctgaa gcctcttctc agaacactgt gaagataata ctgacagtag
     3541 aatcagtgaa aacagcctaa caaaacctct gacatcagta tatcaacttt taacagccca
     3601 ctcactggct tttctaaact accaaaaacc acctgtagga tactgcatta agtcagcatc
     3661 tcagaaacag tggtgtgagt aactgagtca aattgtcaag tactttggat atacatagtg
     3721 tcgagcttta gattggtatg aaattaaaca gcaatgcaaa tagatttaat tcctatttac
     3781 tttaagaatg aaaaacaatg ttcattttcc tacctaaaca gggtggttca acataaaggc
     3841 tgatgttgtg tccgttttgt attttatctt ttgttaaaga tacataaatg acaatactta
     3901 actgtga
//

https://www.ncbi.nlm.nih.gov/nuccore/10 … port=fasta

>XM_005265793.3 PREDICTED: Homo sapiens SLU7 homolog, splicing factor (SLU7), transcript variant X1, mRNA
ATTACGAGATTGGCTTGGATTCTGTCGGATGGACTTGGGGCTAGCTGCGGCGGGGCTGGGTAAGAAAATA
TTGTTAGAACTTGCGGGCGACGGGGAGTTGGGGAACCTGAGAAAATGAGTCGAAGGCTCCTAATTATTGG
ATATATCTTCACGGGGGTGATGAGCCCTCAGGTGTTGAGGGAGCGAGGACGGGGGACCGAAAAGCCACTG
TCCTGAGACCCATTCATGGCACTCGTGCCCTGCCAGGCCAGGCCTGCGTCTTCAGGGAAACAGTCGGGAT
AACTATGAGAGTGTCGCCTTTGTGGCGGTGCCTCGAAGACCTTGAGCAATCCCCGGACTGCGAGCAGGGA
AAGCTGCTTCCAGTACCCAAATTGACAGACTGTATTTCCTCGCCAGAAAAATTTACTTGAGCTTCAGTTT
TTCCTGTTAAGTCGAGATGATCCGACTTCAGTGGGGTATCATGCGGGTATAAATGAAAACATCTATAGGA
GGCCAGATAACCATGTCAGCCACAGTTGTAGATGCAGTTAATGCTGCACCCCTATCGGGGTCCAAAGAAA
TGAGTTTGGAAGAACCAAAGAAGATGACCAGAGAGGACTGGAGAAAGAAGAAGGAGCTAGAAGAACAGCG
AAAATTGGGCAATGCTCCTGCAGAAGTTGATGAAGAAGGAAAAGACATCAACCCCCATATTCCTCAGTAT
ATTTCTTCAGTGCCATGGTATATTGATCCTTCAAAAAGACCTACTTTAAAACACCAGAGACCACAACCAG
AAAAACAAAAGCAGTTCAGCTCATCTGGAGAATGGTACAAGAGGGGTGTAAAAGAGAATTCCATAATTAC
TAAGTACCGCAAAGGAGCATGTGAAAATTGTGGGGCCATGACACACAAAAAGAAAGACTGCTTTGAGAGA
CCTAGGCGAGTTGGAGCCAAATTTACAGGTACTAATATAGCTCCAGATGAACATGTCCAGCCTCAACTGA
TGTTTGACTATGATGGGAAGAGGGATCGGTGGAATGGCTACAATCCAGAAGAACACATGAAAATTGTTGA
AGAGTATGCCAAAGTTGATTTGGCAAAACGAACATTGAAAGCCCAGAAACTCCAAGAGGAATTAGCCTCA
GGAAAATTAGTGGAACAGGCTAATTCTCCAAAACACCAGTGGGGAGAAGAGGAACCAAATTCTCAGATGG
AAAAAGATCATAATAGTGAAGATGAGGATGAAGATAAATATGCAGATGATATTGACATGCCTGGACAGAA
TTTTGACTCCAAGAGACGAATTACTGTCCGGAATCTCAGGATTCGAGAAGATATTGCAAAATATTTGAGG
AATTTAGATCCAAATTCTGCCTACTATGATCCAAAAACTAGAGCAATGAGAGAGAATCCTTATGCCAATG
CAGGAAAGAATCCAGATGAAGTGAGTTATGCTGGAGATAACTTTGTTAGGTACACAGGAGATACCATTTC
AATGGCTCAGACACAGTTGTTTGCATGGGAAGCCTATGACAAGGGATCTGAAGTGCATCTACAGGCAGAT
CCTACAAAGCTAGAGCTGTTGTATAAGTCCTTCAAAGTCAAAAAAGAAGATTTCAAAGAACAGCAGAAAG
AAAGCATCCTGGAAAAGTATGGTGGCCAAGAACATTTGGATGCCCCTCCAGCTGAATTGCTTTTAGCCCA
GACTGAAGACTATGTGGAGTACTCAAGACATGGGACAGTCATCAAAGGACAGGAGCGGGCTGTTGCCTGC
TCTAAGTATGAGGAGGATGTGAAGATCCACAATCACACACATATCTGGGGATCGTACTGGAAAGAAGGCC
GATGGGGATACAAATGCTGTCACTCTTTTTTCAAGTATTCCTATTGTACTGGAGAAGCTGGGAAGGAGAT
TGTTAACTCTGAGGAGTGTATTATAAATGAGATAACTGGGGAAGAATCTGTGAAAAAACCTCAAACCCTC
ATGGAGCTGCATCAAGAAAAACTGAAAGAGGAAAAGAAGAAGAAGAAAAAGAAAAAGAAGAAGCATCGAA
AGAGCAGTTCAGATAGTGATGATGAAGAAAAGAAGCATGAAAAATTGAAAAAGGCACTGAACGCAGAGGA
GGCCCGCCTTCTTCATGTCAAGGAGACCATGCAGATTGATGAGAGGAAGCGGCCTTACAATAGCATGTAT
GAAACTCGAGAACCTACTGAAGAGGAAATGGAGGCATATAGAATGAAACGTCAGAGGCCAGATGACCCCA
TGGCCTCTTTCCTTGGACAGTAGCAACTAGTCAGAAGACCATCCAAGATAGATGCAGCTGATACATTCTT
TTCAGCTTCTTATTGATGATTGTAGATAGAAAAATCCTTGTTTATTCTTCTTGCTGCCTGGCTTTAATAA
ATATTTCAGATGCCTCACAGTAAGTTCACTCCTTTCCATACTGAGGAAACAAGAAAAGAAGAAGAGGCAC
ATGAAGTGTGCTTTTGGGAATAGAATTTAAAATTGGATTAAGATTTTATTTCCAGTTTTTTTTATTTATT
TATTTTTTTTTTTGAGACGGAGTCTTGCTCTGTCGCCCAGGCTGAAGTGCGGTGGCGCGATCTCGGCTCA
CTGCAAGCTCCACCTCCCAGGTTCACGCCATTCTCCTGCCTCAGCCTCCCTAGTAGTTGGGACTACAGGC
GCCCGCCACCATGCTCAGCTAATTTTTTGTATTTTTAGTAGAGACGGTTTCATCGTGTTAGCCAGGATGG
TCTCGATCTCCTGACCTTGTGATCCACCCGCCTCAGCCTCCCAAAGTGCTGAGATTACAGGCGTGAGCCA
CCGCGCCTGGCCTATTTCCAGTTTTATGTGAGTCATGTAAAAAAGCCTTGGCTCTCTACCTATTAAGAAT
GTCTCTTTCTCTGTATTTATTAAGCTTCAAACTTTATTGCTTCGATTTTTGTGGCCCTATATTTAGTATT
AGCACACCTTGGTTTTGAGAAAAAAACAGGGCTTTGTTTTTTTAAATAATTACTAGCAACTCTGTGACTA
CATTTATTTTTATTTTTTTTAGAGACAGGATCTTGCTATGTTGCCCAGGCTAGAGAGCAGTGGCTTTTCA
CAGACAAAGTCATAATGCCCTGCAGTCTTGGGCTCAAGCGATTCTCTCTTCCTTGGCCTCTGGAGTAGAC
TAAATGTGTTAGTCTTTGAATGGAAAACAACTATTTTCTCATCATTGGGTCAATATTGACTGATCAGTAG
TAGGTCTTTTACCATTCTGGACATAAGTCTAGGTGTAGAAATCCTTTCCTTTATCATAGAGGATATGGTT
TACATTACCGTTTGTTTTCATTGTGATTGCCCCTATGTAACAATCATGAATATTAGATTTTTTAAATTGT
AGAATATCCTAATATTTATAGCCAGCAGCTGTTACTTTGTTTGTAAAATTTGCAAAAAAACAAAACCTGA
AGTTGGTTTATTGAAAGAATTATAAGGATAGCTTCTAGGGATATTAGTAATAGATTGCCATGATCCTGAA
GCCTCTTCTCAGAACACTGTGAAGATAATACTGACAGTAGAATCAGTGAAAACAGCCTAACAAAACCTCT
GACATCAGTATATCAACTTTTAACAGCCCACTCACTGGCTTTTCTAAACTACCAAAAACCACCTGTAGGA
TACTGCATTAAGTCAGCATCTCAGAAACAGTGGTGTGAGTAACTGAGTCAAATTGTCAAGTACTTTGGAT
ATACATAGTGTCGAGCTTTAGATTGGTATGAAATTAAACAGCAATGCAAATAGATTTAATTCCTATTTAC
TTTAAGAATGAAAAACAATGTTCATTTTCCTACCTAAACAGGGTGGTTCAACATAAAGGCTGATGTTGTG
TCCGTTTTGTATTTTATCTTTTGTTAAAGATACATAAATGACAATACTTAACTGTGA

Формы, механизмы, энергия наномира. Сообщение 84 323

FT CDS 473..2263
     attacgagat tggcttggat tctgtcggat ggacttgggg ctagctgcgg cggggctggg
     taagaaaata ttgttagaac ttgcgggcga cggggagttg gggaacctga gaaaatgagt
     cgaaggctcc taattattgg atatatcttc acgggggtga tgagccctca ggtgttgagg
     gagcgaggac gggggaccga aaagccactg tcctgagacc cattcatggc actcgtgccc
     tgccaggcca ggcctgcgtc ttcagggaaa cagtcgggat aactatgaga gtgtcgcctt
     tgtggcggtg cctcgaagac cttgagcaat ccccggactg cgagcaggga aagctgcttc
     cagtacccaa attgacagac tgtatttcct cgccagaaaa atttacttga gcttcagttt
     ttcctgttaa gtcgagatga tccgacttca gtggggtatc atgcgggtat aaatgaaaac
     atctatagga ggccagataa ccatgtcagc cacagttgta gatgcagtta atgctgcacc
     cctatcgggg tccaaagaaa tgagtttgga agaaccaaag aagatgacca gagaggactg
     gagaaagaag aaggagctag aagaacagcg aaaattgggc aatgctcctg cagaagttga
     tgaagaagga aaagacatca acccccatat tcctcagtat atttcttcag tgccatggta
     tattgatcct tcaaaaagac ctactttaaa acaccagaga ccacaaccag aaaaacaaaa
     gcagttcagc tcatctggag aatggtacaa gaggggtgta aaagagaatt ccataattac
     taagtaccgc aaaggagcat gtgaaaattg tggggccatg acacacaaaa agaaagactg
     ctttgagaga cctaggcgag ttggagccaa atttacaggt actaatatag ctccagatga
     acatgtccag cctcaactga tgtttgacta tgatgggaag agggatcggt ggaatggcta
     caatccagaa gaacacatga aaattgttga agagtatgcc aaagttgatt tggcaaaacg
     aacattgaaa gcccagaaac tccaagagga attagcctca ggaaaattag tggaacaggc
     taattctcca aaacaccagt ggggagaaga ggaaccaaat tctcagatgg aaaaagatca
     taatagtgaa gatgaggatg aagataaata tgcagatgat attgacatgc ctggacagaa
     ttttgactcc aagagacgaa ttactgtccg gaatctcagg attcgagaag atattgcaaa
     atatttgagg aatttagatc caaattctgc ctactatgat ccaaaaacta gagcaatgag
     agagaatcct tatgccaatg caggaaagaa tccagatgaa gtgagttatg ctggagataa
     ctttgttagg tacacaggag ataccatttc aatggctcag acacagttgt ttgcatggga
     agcctatgac aagggatctg aagtgcatct acaggcagat cctacaaagc tagagctgtt
     gtataagtcc ttcaaagtca aaaaagaaga tttcaaagaa cagcagaaag aaagcatcct
     ggaaaagtat ggtggccaag aacatttgga tgcccctcca gctgaattgc ttttagccca
     gactgaagac tatgtggagt actcaagaca tgggacagtc atcaaaggac aggagcgggc
     tgttgcctgc tctaagtatg aggaggatgt gaagatccac aatcacacac atatctgggg
     atcgtactgg aaagaaggcc gatggggata caaatgctgt cactcttttt tcaagtattc
     ctattgtact ggagaagctg ggaaggagat tgttaactct gaggagtgta ttataaatga
     gataactggg gaagaatctg tgaaaaaacc tcaaaccctc atggagctgc atcaagaaaa
     actgaaagag gaaaagaaga agaagaaaaa gaaaaagaag aagcatcgaa agagcagttc
     agatagtgat gatgaagaaa agaagcatga aaaattgaaa aaggcactga acgcagagga
     ggcccgcctt cttcatgtca aggagaccat gcagattgat gagaggaagc ggccttacaa
     tagcatgtat gaaactcgag aacctactga agaggaaatg gaggcatata gaatgaaacg
     tcagaggcca gatgacccca tggcctcttt ccttggacag tagcaactag tcagaagacc
     atccaagata gatgcagctg atacattctt ttcagcttct tattgatgat tgtagataga
     aaaatccttg tttattcttc ttgctgcctg gctttaataa atatttcaga tgcctcacag
     taagttcact cctttccata ctgaggaaac aagaaaagaa gaagaggcac atgaagtgtg
     cttttgggaa tagaatttaa aattggatta agattttatt tccagttttt tttatttatt
     tatttttttt tttgagacgg agtcttgctc tgtcgcccag gctgaagtgc ggtggcgcga
     tctcggctca ctgcaagctc cacctcccag gttcacgcca ttctcctgcc tcagcctccc
     tagtagttgg gactacaggc gcccgccacc atgctcagct aattttttgt atttttagta
     gagacggttt catcgtgtta gccaggatgg tctcgatctc ctgaccttgt gatccacccg
     cctcagcctc ccaaagtgct gagattacag gcgtgagcca ccgcgcctgg cctatttcca
     gttttatgtg agtcatgtaa aaaagccttg gctctctacc tattaagaat gtctctttct
     ctgtatttat taagcttcaa actttattgc ttcgattttt gtggccctat atttagtatt
     agcacacctt ggttttgaga aaaaaacagg gctttgtttt tttaaataat tactagcaac
     tctgtgacta catttatttt tatttttttt agagacagga tcttgctatg ttgcccaggc
     tagagagcag tggcttttca cagacaaagt cataatgccc tgcagtcttg ggctcaagcg
     attctctctt ccttggcctc tggagtagac taaatgtgtt agtctttgaa tggaaaacaa
     ctattttctc atcattgggt caatattgac tgatcagtag taggtctttt accattctgg
     acataagtct aggtgtagaa atcctttcct ttatcataga ggatatggtt tacattaccg
     tttgttttca ttgtgattgc ccctatgtaa caatcatgaa tattagattt tttaaattgt
     agaatatcct aatatttata gccagcagct gttactttgt ttgtaaaatt tgcaaaaaaa
     caaaacctga agttggttta ttgaaagaat tataaggata gcttctaggg atattagtaa
     tagattgcca tgatcctgaa gcctcttctc agaacactgt gaagataata ctgacagtag
     aatcagtgaa aacagcctaa caaaacctct gacatcagta tatcaacttt taacagccca
     ctcactggct tttctaaact accaaaaacc acctgtagga tactgcatta agtcagcatc
     tcagaaacag tggtgtgagt aactgagtca aattgtcaag tactttggat atacatagtg
     tcgagcttta gattggtatg aaattaaaca gcaatgcaaa tagatttaat tcctatttac
     tttaagaatg aaaaacaatg ttcattttcc tacctaaaca gggtggttca acataaaggc
     tgatgttgtg tccgttttgt attttatctt ttgttaaaga tacataaatg acaatactta
     actgtga
//

Композиционный код:

1,3,2,3,2,2,1,1,2,1,1,2,1,2,3,2,3,2,3,3,3,2,1,2,4,4,1,3,3,1,3,1,3,3,2,1,1,1,1,3,1,1,1,3,1,1,1,1,2,3,3,1,2,3,1,1,3,
3,3,2,3,3,3,3,3,2,3,1,1,1,1,3,3,3,1,3,3,3,2,4,2,1,3,3,3,3,2,3,3,3,3,3,3,1,1,3,2,3,2,3,3,3,1,1,1,1,2,3,2,3,1,1,1,1,
3,2,3,1,3,1,2,3,3,1,1,1,3,2,2,3,3,3,3,4,1,1,2,1,3,1,3,1,1,3,1,3,3,1,2,3,2,1,3,3,2,3,3,3,2,3,2,3,3,3,1,1,3,3,4,1,3,
1,3,3,4,1,1,3,4,1,3,1,1,3,2,3,3,1,1,3,3,3,3,1,3,1,3,3,3,1,2,3,2,2,1,3,1,1,3,1,3,1,3,3,1,2,2,3,3,4,3,1,3,3,3,2,3,1,
1,1,2,3,1,3,2,3,3,1,1,3,3,3,3,3,3,3,3,1,3,3,3,3,3,2,3,3,3,1,1,3,2,1,3,3,1,1,1,3,2,3,3,1,4,3,1,1,3,2,3,3,3,2,3,3,1,
1,3,3,3,2,3,3,1,1,3,3,2,3,3,3,2,1,3,1,3,3,3,1,3,2,2,1,3,2,3,3,4,3,3,3,2,3,1,3,3,1,1,2,2,3,1,3,2,1,3,1,2,1,1,3,2,1,
3,1,3,1,1,2,3,3,4,3,2,1,2,3,3,2,1,2,1,4,1,3,1,1,1,3,1,3,3,3,3,1,3,3,1,1,3,3,1,1,4,3,1,3,3,1,3,3,3,1,3,1,3,2,3,3,1,
3,3,1,1,3,3,1,3,4,1,1,2,3,3,4,2,1,1,3,2,1,1,4,3,3,1,1,3,1,3,1,1,3,4,1,1,1,3,1,2,3,1,1,2,4,1,1,3,3,1,2,1,2,1,3,1,3,
1,3,3,1,1,3,1,3,3,3,2,3,3,4,1,1,3,3,1,3,1,1,3,3,2,3,1,2,3,4,3,3,3,4,3,3,3,3,1,1,1,1,4,3,3,3,3,4,3,1,3,1,1,1,1,3,1,
3,1,1,1,3,2,1,1,3,2,3,3,3,3,3,3,1,1,3,3,3,1,3,1,2,4,1,2,1,1,1,1,3,3,3,1,1,1,1,1,1,3,3,1,1,1,4,3,1,3,1,1,3,3,3,2,3,
3,3,3,1,3,1,1,2,3,3,1,3,3,1,1,2,3,1,1,1,1,3,1,3,2,1

Вторичная структура (Пикотех): https://img-fotki.yandex.ru/get/243369/ … 1_orig.gif

https://img-fotki.yandex.ru/get/112407/158289418.3bd/0_170114_849276c6_orig.png
В этом белке лизин образует два противонаправленных участка альфа-спирали!