111

Re: Пикотехнология белков, ДНК, РНК - 2

T0680

FT   CDS             1..357
     ATGAGCATTC GATGGATGAT GGCCGCAGGC CTCGCCGCGC TGACCCTGAG CGGTTGTGCG
     AGCAACGACC CGGCTCCGCT GGAGCAGATG CGCCTGACCG AACAGGCGCT GGAGCAGGCC
     AAGGCGGTGG GTGCCACCGA CGACGTGGCC GAGCTGAAAC TGGCCCAGGA CAAGTACGCC
     GCGGCGCAGA TCGCGATGAC CGCGGAGTCC TACAAGAAGG CGCGCCTGTT GGCCGAGCAG
     GCCGAGCTGG ATGCACGCCT CGCCGAGTCC AAGGTGCTGA CGCAGAAGAG CAAGGACCAG
     CTCGGCGAGC TGGACAAGAG CCTGAAACGT CTGCGCAAGC AACTGGGGGA GACCGAC
//

Композиционный код:

1,1,3,2,1,1,1,1,2,1,1,1,4,4,1,4,1,3,3,4,1,1,1,4,3,4,4,1,1,1,
1,4,1,3,1,4,4,1,1,1,1,4,4,3,1,1,1,1,4,1,1,4,3,4,1,1,1,1,1,1,
4,4,1,1,4,1,1,4,1,1,1,1,1,4,1,4,1,1,1,1,1,1,4,3,2,1,1,1,1,1,
1,4,4,4,1,1,1,1,1,1,1,1,1,4,1,1,1,4,3,3,4,1,1,3,4,4,1,1,1

http://img-fotki.yandex.ru/get/6210/126580004.57/0_bd45d_d7a9d0d7_orig.gif

http://img-fotki.yandex.ru/get/6212/126580004.57/0_bd460_4320ebd1_L.png
Оригинал: http://img-fotki.yandex.ru/get/6212/126 … 1_orig.png

http://img-fotki.yandex.ru/get/6306/126580004.57/0_bd45f_6948727f_S.gif
Оригинал: http://img-fotki.yandex.ru/get/6306/126 … f_orig.gif

112

Re: Пикотехнология белков, ДНК, РНК - 2

T0681

FT   CDS             1..672
     ATGAAAAAGA TTATACCTTT CTTTATTATG ATATGTTGTT TGTTGGCAGT AAGCAGTTGC
     AGCTACGACA ACTTTGAGGA ACCTAAAGCC ACATTAACCG GAAAAGCTAT TTATGACGGT
     GAGGCAGTAG GGGTTAGAAG CGGAAGTTCC GAATTTGCTT TGTTTCAGGA TGGTTATGCT
     CTGAAAGGTT CTATTCCGGT GTATATTGCC CAAGATGGAA GTTATTCCGT GTCCCTTTTC
     AATGGTGATT ACAAATTGGT GCGTATGGGC AATGCACCTT GGGAAAGACC TTCTAATGAT
     ACGATCTATA TTACCGTAAG AGGAAACACA GTGCAGGATA TTCCTGTGAC GCCGTATTTC
     TTTGTCAGAA ACGTGTCATT TGCCAAAAAC GGTAATAAGA TTACAGCACG TTTCACCATT
     AACAAAGTGG TTGCCAATGC CAATATGGAA AATGTAGGTA TTTATCTGGG TACAGGTATC
     CTGACGGATG AGAAGCAGAA AGAAGCAGAG TTGAAGTTGG GTAATACTGT TTCACTCGAT
     CAAGAAAACA CAGCTGAAAT TGAAATCCCG AGTGGTTTGG TAAACGAATC GTATCTTTAC
     GCCCGTGTGG GAGTCAAATC GGACAAATCA TCAGAATATT GCTATAGTCA GTCTATTAAG
     GTAGCATTGA AA
//

Композиционный код:

1,3,1,3,2,3,1,3,3,1,2,3,3,1,1,2,2,1,3,1,1,1,1,1,3,1,3,3,3,1,
2,3,1,2,3,3,3,3,1,3,1,2,2,4,3,3,1,2,3,1,3,3,3,1,3,1,3,3,3,3,
4,3,3,3,3,4,4,3,3,1,3,3,2,3,3,1,4,1,3,1,3,3,3,1,3,1,4,3,1,1,
3,2,3,1,3,3,3,3,3,3,4,1,3,3,1,2,3,2,1,2,4,1,3,3,3,4,4,4,3,1,
3,1,3,1,4,2,3,1,3,1,3,3,1,3,2,2,3,1,1,3,1,3,4,3,1,3,1,3,1,3,
3,2,3,3,3,4,3,2,3,1,4,4,3,1,1,1,3,3,2,1,1,1,1,3,3,3,3,2,1,3,
3,3,1,2,3,3,3,3,1,4,3,3,1,2,1,3,4,3,3,1,1,3,4,2,1,3,4,1,3,2,
2,3,3,1,3,3,1,3,3,1,2,2,1,3

http://img-fotki.yandex.ru/get/6305/126580004.57/0_bd45e_9872137_orig.gif

http://img-fotki.yandex.ru/get/6212/126580004.57/0_bd462_49952ff5_L.png
Оригинал: http://img-fotki.yandex.ru/get/6212/126 … 5_orig.png

http://img-fotki.yandex.ru/get/6310/126580004.57/0_bd461_c08be193_S.gif
Оригинал: http://img-fotki.yandex.ru/get/6310/126 … 3_orig.gif

113

Re: Пикотехнология белков, ДНК, РНК - 2

PDB-файлы T0644 ... T0681 можно скачать отсюда:

http://nanoworld88.narod.ru/pdb/T0644.pdb
http://nanoworld88.narod.ru/pdb/T0645.pdb
http://nanoworld88.narod.ru/pdb/T0647.pdb
http://nanoworld88.narod.ru/pdb/T0648.pdb
http://nanoworld88.narod.ru/pdb/T0649.pdb
http://nanoworld88.narod.ru/pdb/T0650.pdb
http://nanoworld88.narod.ru/pdb/T0651.pdb
http://nanoworld88.narod.ru/pdb/T0652.pdb
http://nanoworld88.narod.ru/pdb/T0653.pdb
http://nanoworld88.narod.ru/pdb/T0654.pdb
http://nanoworld88.narod.ru/pdb/T0655.pdb
http://nanoworld88.narod.ru/pdb/T0656.pdb
http://nanoworld88.narod.ru/pdb/T0657.pdb
http://nanoworld88.narod.ru/pdb/T0660.pdb
http://nanoworld88.narod.ru/pdb/T0661.pdb
http://nanoworld88.narod.ru/pdb/T0662.pdb
http://nanoworld88.narod.ru/pdb/T0663.pdb
http://nanoworld88.narod.ru/pdb/T0664.pdb
http://nanoworld88.narod.ru/pdb/T0665.pdb
http://nanoworld88.narod.ru/pdb/T0666.pdb
http://nanoworld88.narod.ru/pdb/T0667.pdb
http://nanoworld88.narod.ru/pdb/T0668.pdb
http://nanoworld88.narod.ru/pdb/T0669.pdb
http://nanoworld88.narod.ru/pdb/T0670.pdb
http://nanoworld88.narod.ru/pdb/T0671.pdb
http://nanoworld88.narod.ru/pdb/T0672.pdb
http://nanoworld88.narod.ru/pdb/T0673.pdb
http://nanoworld88.narod.ru/pdb/T0674.pdb
http://nanoworld88.narod.ru/pdb/T0675.pdb
http://nanoworld88.narod.ru/pdb/T0676.pdb
http://nanoworld88.narod.ru/pdb/T0677.pdb
http://nanoworld88.narod.ru/pdb/T0678.pdb
http://nanoworld88.narod.ru/pdb/T0679.pdb
http://nanoworld88.narod.ru/pdb/T0680.pdb
http://nanoworld88.narod.ru/pdb/T0681.pdb

114

Re: Пикотехнология белков, ДНК, РНК - 2

Уважаемая Виктория!

Хотелось бы внести ясность:

Victoria пишет:
Kushelev пишет:

Уважаемая Виктория!

Мне хотелось бы всё-таки услышать Ваш ответ по поводу 310-спирали гонадотропина. Я хочу понять, каким образом Вы без композиционных кодов 4 сможете получить модель 310-спирали?

http://nanoworld88.narod.ru/data/209.files/0_48027_3b50efe_orig.gif
Программа Prosolver по Вашему алгоритму не показывает никакой спирали...

Как впрочем и для пи-спирали:

http://nanoworld88.narod.ru/data/288_files/0_85d09_8d7f6a3d_orig.gif

А.Ю., начнём с того, что AY307175 кодирует Ichthyomyzon unicuspis (белок, управляющий высвобождением предшественника гонадотропина: preprogonadotropin-releasing hormone III).

Собственно гонадотропин: Choriogonadotropin subunit beta (Human) является полипептидом из 165 а.о. с двумя изоформами:

>sp|P01233|CGHB_HUMAN Choriogonadotropin subunit beta OS=Homo sapiens GN=CGB PE=1 SV=1
MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPT
MTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDC
GGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ

и кодируется EMBL-CDS: AAA96690.1 :

FT   CDS             1..495
     ATGGAGATGT TCCAGGGGCT GCTGCTGTTG CTGCTGCTGA GCATGGGCGG GACATGGGCA
     TCCAAGGAGC CGCTTCGGCC ACGGTGCCGC CCCATCAATG CCACCCTGGC TGTGGAGAAG
     GAGGGCTGCC CCGTGTGCAT CACCGTCAAC ACCACCATCT GTGCCGGCTA CTGCCCCACC
     ATGACCCGCG TGCTGCAGGG GGTCCTGCCG GCCCTGCCTC AGGTGGTGTG CAACTACCGC
     GATGTGCGCT TCGAGTCCAT CCGGCTCCCT GGCTGCCCGC GCGGCGTGAA CCCCGTGGTC
     TCCTACGCCG TGGCTCTCAG CTGTCAATGT GCACTCTGCC GCCGCAGCAC CACTGACTGC
     GGGGGTCCCA AGGACCACCC CTTGACCTGT GATGACCCCC GCTTCCAGGA CTCCTCTTCC
     TCAAAGGCCC CTCCCCCCAG CCTTCCAAGC CCATCCCGAC TCCCGGGGCC CTCGGACACC
     CCGATCCTCC CACAA
//

Это белок с такой закодированной вторичной структурой:

http://img-fotki.yandex.ru/get/6304/137150420.6/0_74c53_343014d4_XL.jpg
http://fotki.yandex.ru/users/sokolik67- … ew/478291/

и таким структурным шаблоном:

http://img-fotki.yandex.ru/get/6110/137150420.6/0_74c54_f5b11a52_XL.jpg
http://fotki.yandex.ru/users/sokolik67- … ew/478292/.

Та картинка и аминокислотная последовательность, с которой Вы ко мне пристаёте, гонадотропином НЕ является. Если Вам и дальше интересно обсуждать структуру такого зверя как Ichthyomyzon unicuspis preprogonadotropin-releasing hormone III, то это в конце дня, как вернусь с работы.

Кушелев: Любопытно, но и в гонадотропине есть такая же 310-спираль:

http://img-fotki.yandex.ru/get/6301/126580004.56/0_bd38b_fc30f2d2_orig.gif
Вторичная структура гонадотропина полностью (по Кушелеву и по Соколик): http://img-fotki.yandex.ru/get/6300/126 … 9_orig.gif

Композиционный код:

1,1,1,1,1,4,4,4,4,1,4,4,4,1,1,1,4,2,1,2,1,1,1,4,3,4,2,4,1,1,
1,1,3,1,1,4,3,4,1,1,1,1,1,1,4,1,1,1,1,1,1,1,1,3,1,1,1,1,1,1,
1,1,1,4,4,1,4,1,4,4,1,4,3,1,4,4,1,1,1,1,3,4,1,1,1,1,1,4,1,3,
1,1,4,1,1,4,1,1,4,1,1,1,1,4,3,1,1,3,3,3,2,1,1,1,1,1,1,3,1,1,
4,3,1,1,1,1,1,1,1,3,3,1,1,1,1,1,1,1,3,1,2,1,1,3,1,1,1,3,2,1,
2,1,2,1,4,4,1,4,1,1,4,1,1,2,3

http://img-fotki.yandex.ru/get/6305/126580004.56/0_bd38c_744bb11c_S.gif
Оригинал: http://img-fotki.yandex.ru/get/6305/126 … c_orig.gif
Пикотехнологическая пространственная модель гонадотропина.

PDB-файл: http://nanoworld88.narod.ru/pdb/gonadotropin.pdb

http://img-fotki.yandex.ru/get/6301/126580004.56/0_bd38d_5b344771_S.gif
Оригинал: http://img-fotki.yandex.ru/get/6301/126 … 1_orig.gif
Пикотехнологическая модель фрагмента (310-спирали) гонадотропина.

PDB-файл: http://nanoworld88.narod.ru/pdb/gonadot … agment.pdb

Вот мне и интересно знать, как Вы объясняете наличие 310-спирали в гонадотропине. Экспериментально она там обнаружена и программа "Пикотех" тоже её показывает...

115

Re: Пикотехнология белков, ДНК, РНК - 2

А Вы могли бы привести файл (экспериментальный) из PDB для спирали 3-10 гонадотропина или хотя бы публикацию с обсуждением экспериментальных данных по этой проблеме. Как только наша дискуссия перейдёт с предметную плоскость, так сразу я и буду объяснять.

116

Re: Пикотехнология белков, ДНК, РНК - 2

http://nanoworld.org.ru/post/16031/#p16031

Игорь пишет:
Kushelev пишет:

http://img-fotki.yandex.ru/get/5503/nanoworld2003.e/0_474b3_9228659b_orig.gif
В миноре Кушелева плоскости азотистых оснований ортогональны, но связь водородная, а в случае непосредственной связи между атомом углерода и азота разных колец может получиться экзотическая связь...

Напишите, пожалуйста, структурную формулу минора Кушелева.

С-U
Любопытно, что этой формуле соответствуют как минимум 2 изомера, т.е. в тРНК встречается минорная пара C-U не только с перпендикулярным расположением азотистых оснований, но и с расположением их в одной плоскости. При этом длина пар-изомеров C-U естественно отличается. Встречается и минорная пара U-U, основания которой лежат в одной плоскости (как минимум в одном изомере).

117

Re: Пикотехнология белков, ДНК, РНК - 2

http://img-fotki.yandex.ru/get/6307/70695945.c/0_8d375_1b873d4_S.gif
Оригинал: http://img-fotki.yandex.ru/get/6307/706 … 4_orig.gif

Кушелев: Пикотехнологическая модель гексанитробензола.

118

Re: Пикотехнология белков, ДНК, РНК - 2

Victoria пишет:

А Вы могли бы привести файл (экспериментальный) из PDB для спирали 3-10 гонадотропина или хотя бы публикацию с обсуждением экспериментальных данных по этой проблеме. Как только наша дискуссия перейдёт с предметную плоскость, так сразу я и буду объяснять.

Кушелев: О 310-спирали гонадотропина мне рассказал специалист по молекулярной биологии. Давайте попробуем вместе найти научную статью, где сообщается о 310-спирали гонадотропина.

119

Re: Пикотехнология белков, ДНК, РНК - 2

Кстати, существует ли антигонадотропин или это словечко из жёлтой прессы?

120

Re: Пикотехнология белков, ДНК, РНК - 2

http://img-fotki.yandex.ru/get/6211/126580004.57/0_bd5d2_d6d0104d_orig.jpg
Источник информации: http://www.xumuk.ru/encyklopedia/486.html

Кушелев: Интересно было бы построить пикотехнологическую модель этого белка. Уважаемая Виктория! Вы не могли бы найти нуклеотидную последовательность этой малатде-гидрогеназы?