1,231

Re: Пикотехнология белков, ДНК, РНК

Здравствуйте, Александр!
Большое Вам спасибо за быстрый ответ. Если Вам удобно давайте я позвоню *****. В Москву может быть получится приехать в ***** ...
С уважением,

Кушелев: ОК! А сегодня я могу Вас зарегистрировать на форуме лаборатории Наномир: http://nanoworld.org.ru/topic/5/page/124/
Где мы можем обсудить Ваши заказы с иллюстрациями и ссылками.

1,232

Re: Пикотехнология белков, ДНК, РНК

Виктория! С праздником Вас!
http://march8.ru/uu.jpg
C 8 Марта!

1,233

Re: Пикотехнология белков, ДНК, РНК

http://www.nanoworld.org.ru/data/01/data/images/slides/20001217/020.jpg
А мне хотелось бы поздравлять прекрасных женщин вечно smile
Желаю всем женщинам стать вечно-молодыми!

1,234

Re: Пикотехнология белков, ДНК, РНК

Спасибо Вам smile

1,235

Re: Пикотехнология белков, ДНК, РНК

http://img-fotki.yandex.ru/get/6203/126580004.49/0_b6b6a_3a398bb4_S.gif
Оригинал: http://img-fotki.yandex.ru/get/6203/126 … 4_orig.gif

Новая версия программы Пикотех уже строит стебель белковой молекулы, сохраняя pdb-файл с координатами общих атомов NCCO. Не все параметры ещё настроены, но прогноз положительный...

http://img-fotki.yandex.ru/get/6202/126580004.49/0_b6b6b_2b82463d_L.png
Оригинал: http://img-fotki.yandex.ru/get/6202/126 … d_orig.png
Программа RasTop может показать участок альфа-спирали по сохранённому pdb-файлу.

1,236

Re: Пикотехнология белков, ДНК, РНК

Стандарт GENETICS - альтернатива стандарту PDB

http://www.nanoworld.org.ru/data/01/dat … enetic.htm

Цитата:

ЯЗЫК GENETICS

В каталоге GENS содержатся гены виртуальной реальности.

01 ... 108 - электронные структуры атомов по порядковым номерам.
01n... 32n - нуклонные структуры атомов по порядковым номерам.
H3PO4 - электронная поверхность молекулы фосфорной кислоты.
ACID - электронная структура аминокислоты Gly.
ALMAZ - электронная структура кристалла алмаза.
GERON - структура цепочки Герона Александрийского.
NANO - планкионная структура наномира.
PIKO - вихронная структура пикомира.
PLAST - электронная структура одноатомного слоя кристалла.
RESON18 - форма диэлектрического генератора.
VIZANROT - формы проводящих генераторов византийского стиля.

Список команд, составляющих гены:

F - фиксировать, т.е. проявить невидимое кольцо
сn - задать цвет группы под номером n.
g n [m] - группировать с n по m от конца списка элементов.
sx - симметрия по оси x от начала координат.
mx p - параллельный перенос по оси x на расстояние p.
rx p - поворот вокруг оси x на угол p градусов.
p p - масштабировать группу как единое целое в p раз.

Конец цитаты.

Первые браузеры, которые могут открывать файлы в стандарте GENETICS были созданы в 1993-ем году:

http://www.nanoworld.org.ru/data/01/dat … readme.htm

Первая библиотека объектов в стандарте GENETICS была создана в 1993-ем году: http://www.nanoworld.org.ru/data/01/dat … netics.zip

Типовой файл в стандарте GENETICS:

ia
ip
ry45
rx54.33
p.77
my-1.4
g1
c0

По этому файлу браузер воспроизводит 3D модель аминокислоты аланина Ala:

http://nanoworld88.narod.ru/data/279_files/0_b3184_d4a57fbc_M.gif

Напомню, что в старом стандарте PDB можно задать только центры атомов, которые стандартный браузер соединяет палочками (часто с ошибками...). При этом файл аланина будет выглядеть приблизительно так:

ATOM     50  N   ALA A   8      -7.629   8.248  15.994  1.00 27.90           N 
ATOM     51  CA  ALA A   8      -7.831   8.117  17.436  1.00 29.42           C 
ATOM     52  C   ALA A   8      -9.103   7.326  17.713  1.00 30.29           C 
ATOM     53  O   ALA A   8      -9.117   6.407  18.537  1.00 32.71           O 
ATOM     54  CB  ALA A   8      -7.926   9.489  18.083  1.00 29.86           C

Если же задать координаты всех электронов в новом стандарте PDB-PIKO, то получится приблизительно такая картина:

ATOM      1  N   ALA A   1       1.997   1.595  -0.678  1.00  0.50      A
ATOM      2  CA  ALA A   1       2.041   0.787  -0.138  1.00  0.50      A   
ATOM      3  C   ALA A   1       1.391   0.625   0.625  1.00  0.50      A   
ATOM      4  O   ALA A   1       1.323   0.608   1.312  1.00  0.50      A   
ATOM      5  CB  ALA A   1       2.632   0.934   0.612  1.00  0.50      A
E 0000001 001 O S CA  ALA A 0.248640E01   0.898200E00 -0.300600E00  1.00 38.49           N
E 0000002 002 O S CA  ALA A 0.187160E01   0.115420E01  0.132400E00  1.00 38.49           N
E 0000003 003 O S CA  ALA A 0.206380E01    0.383500E00    0.132400E00  1.00 38.49           N
E 0000004 004 O S CA  ALA A 0.221150E01    0.420300E00    -0.408400E00  1.00 38.49           N
E 0000004 004 O S CA  ALA A 0.174460E01    0.713300E00    -0.516100E00  1.00 38.49           N
E 0000005 001 O S C   ALA A 0.504500E00    0.404100E00    -0.515200E00  1.00 38.49           N
E 0000006 002 O N C   ALA A 0.540200E00    0.412900E00    0.045300E00  1.00 38.49           N
E 0000007 003 O S C   ALA A 0.102070E01    0.123400E00    0.019400E00  1.00 38.49           N
E 0000008 004 O N C   ALA A 0.828500E00    0.894200E00    0.019400E00  1.00 38.49           N
E 0000009 001 O S O   ALA A 0.985300E00    0.114600E00    -0.541200E00  1.00 38.49           N
E 0000010 002 O N O   ALA A 0.793100E00    0.885300E00    -0.541200E00  1.00 38.49           N
E 0000011 003 O S O   ALA A 0.127360E01    0.595800E00    -0.567200E00  1.00 38.49           N
E 0000012 004 O N O   ALA A 0.102290E01    0.942600E00    0.596700E00  1.00 38.49           N
E 0000013 005 O S O   ALA A  0.121510E01    0.171900E00    0.596700E00  1.00 38.49           N
E 0000014 006 O N O   ALA A  0.156500E01    0.107780E01    0.655400E00  1.00 38.49           N
E 0000015 001 O S  N  ALA A 0.175720E01    0.307100E00    0.655400E00  1.00 38.49           N
E 0000016 002 O N  N  ALA A 0.100880E01    0.529800E00    0.167800E01  1.00 38.49           N
E 0000017 003 O S  N  ALA A 0.155090E01    0.665000E00    0.173650E01  1.00 38.49           N
E 0000018 004 O N  N  ALA A 0.168720E01    0.289600E00    0.134160E01  1.00 38.49           N
E 0000019 005 O S  N  ALA A 0.149500E01    0.106030E01    0.134160E01  1.00 38.49           N
E 0000020 006 O N  N  ALA A 0.114510E01    0.154500E00    0.128290E01  1.00 38.49           N
E 0000021 007 O S  N  ALA A  0.952900E00    0.925200E00    0.128290E01  1.00 38.49           N
E 0000022 001 O N CB ALA A  0.245720E01    0.481300E00    0.631700E00  1.00 38.49           N
E 0000023 002 O S CB ALA A  0.238340E01    0.872500E00    0.102850E01  1.00 38.49           N
E 0000024 003 O N CB ALA A  0.292840E01    0.100840E01    0.995800E00  1.00 38.49           N
E 0000025 004 O S CB ALA A  0.300210E01    0.617200E00    0.599000E00  1.00 38.49           N
E 0000026 005 O N CB ALA A  0.226510E01    0.125280E01    0.631900E00  1.00 38.49           N
E 0000027 006 O S CB ALA A  0.280960E01    0.138860E01    0.599200E00  1.00 38.49           N
E 0000028 007 O N CB ALA A  0.288330E01    0.997000E00    0.2021 00E00  1.00 38.49           N

Согласитесь, что эта запись:

ia
ip
ry45
rx54.33
p.77
my-1.4
g1
c0

гораздо компактнее. При этом может быть задана более высокая точность положения электронов и атомных ядер.

Пикотехнология белков, ДНК, РНК

В этой строке скрипта Дениса Савина задаются параметры модели электрона:

local tObj = torus smooth:2 radius1:0.0001 radius2:0.00005 segs:fSegs sides:fSides position:[0,0,0] prefix:"tempCRO_eRing_" wirecolor:c1

Задав очень малые радиусы и выведя файл ASE мне удалось получить координаты центров электронов аланина для демонстрации примера записи в новом стандарте PDB-PIKO

http://img-fotki.yandex.ru/get/6202/126580004.49/0_b6c03_84a64087_L.jpg

http://img-fotki.yandex.ru/get/6103/126580004.49/0_b6c05_7bc1daac_L.jpg
В стандарте GENETICS качество представления модели не влияет на объём файла. Напомню, что в среднем на одну модель в стандарте GENETICS нужно около 20 байт. Такая компактность моделей связано с фрактальностью представления данных.

1,237

Re: Пикотехнология белков, ДНК, РНК

Уважаемая Виктория!
Мне пришло письмо от организаторов CASP. Вы не могли бы прочесть и перевести основную мысль?
Заранее благодарю!

Dear CASPers,

The CASP ROLL experiment is in full swing with more than 50 groups contributing. With the release of today's target we are at the 15-target mark. CASP ROLL registration is still open and it is not too late to join the experiment.

We have recently polled the community concerning interest in the additional structure-guided prediction experiments (contact-guided structure prediction, chemical shifts-guided modeling of NMR structures and structure modeling based on molecular replacement using ab initio models and crystallographic diffraction data).

The biggest interest was expressed for the contact-guided structure prediction. Therefore, we are going forward with this initiative next Monday.

We will be releasing 3 to 5 long-range contacts for some of the more challenging targets, provided we can get coordinates in advance and have enough time (at least 2 weeks) for re-prediction. The definition of residues in contact will be the one used in CASP contact prediction category: 8A distance between C-beta atoms (or C-alpha for glycine). For release, we will select contacts based on the specifics of target's fold and the success in prediction of particular contacts. Priority will be given to contacts important for correct protein folding and those where fewer than 10% of predictors were able to identify them.

Targets will be called based on the name of the original target. For example, the target for contact-guided prediction of the regular CASP ROLL target R0010 will be called Rc010 (notice the small letter 'c' in target's name). Information about the new targets will be made available through the main experiment Target List page. Contact information will be provided at the target-specific pages under the Additional Information section and also as a separate file available for download from the predictioncenter.org/download_area/CASPROL/extra_experiments/ page. Format for releasing contacts will be as follows:

REMARK Rc010: CONTACT-GUIDED STRUCTURE PREDICTION
CONTACT_1: 167A:25C
CONTACT_2: 116L:77K
...

Predictions should be submitted according to the rules of the corresponding main experiment, i.e. for targets originating from the CASP_ROLL experiment,  predictions should be sent using the CASP ROLL web submission form or by sending an email to the casprol account.

If you do not currently participate in CASP ROLL but would like to participate in contact-guided structure prediction, you should register for CASP ROLL first and then send us predictions using the assigned CASP ROLL group code.

We look forward to a successful contact-guided prediction experiment next week!

CASP organizers

1,238

Re: Пикотехнология белков, ДНК, РНК

Основных положений несколько:

1. Они выпустили 15 задачу.
2. Регистрация ещё открыта, но поспешите, чтобы не было слишком поздно. В конкурсе участвует более 50 групп.
3. Они рассматривали дополнительные способы предсказания структуры и в следующий понедельник будут выпускать 3 - 5 контактов дальнего действия (8 ангстрем) для некоторых из наиболее стимулирующих целей, если смогут получить координаты заранее и иметь достаточно времени (по крайней мере 2 недели) для перепредсказания.
4.Эти задачи будут называться по имени исходных с добавлением (с): например Rc010 для R0010. Имеется ввиду метод УПРАВЛЯЕМОГО КОНТАКТОМ ПРЕДСКАЗАНИЯ (?).

1,239

Re: Пикотехнология белков, ДНК, РНК

Очередная наша задача:

>R0015 BACOVA_04221, Bacteroides ovatus ATCC 8483, 261 residues
MKKLSLLLLLSVFIFCGCSDDDDTKTYILSLPNYETHTLDMGDQENPDDSWSVSSEWGTT
NYKYNLLTDASGIFEFDCVSSTYGFYSDSFAFTNCTVEDCPDFASYDYRAITKKGVINNT
YVIVGAAGYKIGKNSDKEAAIRFRDHDNPNELEDYRVKGLYVTNSVYAYSSMKEGTGYYG
EEEIFGSNDSFKLTIYNYDKTMHVDCYLAEGTNLLDQWKWVDLTSLGETKGLKFSLTSTK
KNEYGPLTPTYFCLDGITIED

1,240

Re: Пикотехнология белков, ДНК, РНК

Victoria пишет:

Основных положений несколько:

1. Они выпустили 15 задачу.
2. Регистрация ещё открыта, но поспешите, чтобы не было слишком поздно. В конкурсе участвует более 50 групп.
3. Они рассматривали дополнительные способы предсказания структуры и в следующий понедельник будут выпускать 3 - 5 контактов дальнего действия (8 ангстрем) для некоторых из наиболее стимулирующих целей, если смогут получить координаты заранее и иметь достаточно времени (по крайней мере 2 недели) для перепредсказания.
4.Эти задачи будут называться по имени исходных с добавлением (с): например Rc010 для R0010. Имеется ввиду метод УПРАВЛЯЕМОГО КОНТАКТОМ ПРЕДСКАЗАНИЯ (?).

Кушелев: Благодарю!

Наконец, ответили на мой вопрос на форуме FORCASP: http://predictioncenter.org/forcasp/vie … 055ac365ff

Пишут про какой-то митинг...