61

Re: Формы, механизмы, энергия наномира - 103

Формы, механизмы, энергия наномира. Сообщение 103 031

Готовится 667-ой выпуск рассылки "Новости лаборатории Наномир":

https://subscribe.ru/catalog/science.news.nanoworldnews

Дайджест:

Триумф пикотехнологии очевиден!
Музыка сборки белка RCH94596 в аранжировке Александра Кушелева (mp3)
Прелюдия арии прекурсора в музыкальном размере 99/8
В нотах сборки белка обнаружилась мелодия в разных масштабах времени...
Новая концепция 3D-принтеров "Полигоналка"

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/nDFBwgyC-6zzOA

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/RbV-Te2qx0hyPw http://nanoworld88.narod.ru/data/237_files/0_4e1a8_e8302c5f_M.gif

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/AqNvNU1_DMpjKg

http://nanoworld88.narod.ru/data/248_files/0_5197a_14ad55f9_L.png

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/rnr_-jj3JNLiMA

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/eAg3dGYl5S6b2A

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/fn_PkLIyskcRig

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/7aPfi5F7tHC96g

***

Готовится 4-ый выпуск платной рассылки "Ноу-хау лаборатории Наномир":

http://nanoworld.org.ru/topic/2005/

Дайждест:

Лазерный томографический многоцветный 3D принтер (концепт)
Ноу-хау принтеров нового поколения "Полигоналка" и "Фракталка"
Как измерить диэлектрические потери горной породы на берегу моря и на почте за считанные секунды?
Смоделируем фрактальный эллипсоид треугольного тока?
Моделирование и измерение параметров гибридного резонатора
Измерены резонансные частоты рубинового эллипсоида без зеркал
Стартовала экспедиция на Завод и в зону добычи каменных эллипсоидов
Экспедиция в экспедиции...
Найден способ возбуждения составного рубинового резонатора до уровня свечения рубина без поверхностного пробоя на стыках блоков.
Инструмент, с помощью которого построены египетские пирамиды.
Чипированный. Часть 1. Череп Нефертити (конструктивная фантастика)
Снимаем музыкальный клип "Рождение молекулы" под музыку сборки программной спирали белка в профессиональной аранжировке
Гений попадает в цель, которую никто не видит...

http://mrt-rus.info/upload/medialibrary/fc7/fc72d8389291c495668253881c3e22fb.gif

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/mGaKKdGjmNe2hA

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/T-vV1zj83qw5mA

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/7Eqfsw5UdIBq5w

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/3AJnGOhBtfx_vQ

https://i1.wp.com/tourpedia.ru/wp-conte … .jpg?w=800

http://enz-design.ru/wp-content/uploads/IMG_8864.jpg

https://getfile.dokpub.com/yandex/get/h … A3Lrsgce8w

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/Q95CtQ_c8H8w8g

https://getfile.dokpub.com/yandex/get/h … lmyYs054og

https://img-fotki.yandex.ru/get/6433/15 … 335_XL.jpg

https://getfile.dokpub.com/yandex/get/h … 9Y2T5kByOA

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/ATtqMTv2yWE-ag

https://getfile.dokpub.com/yandex/get/h … KMJzVn_bVg

https://getfile.dokpub.com/yandex/get/h … 95GnpP36DQ

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/_sSQuV-VQhiRoQ

https://getfile.dokpub.com/yandex/get/h … eIz6JYjwJQ

https://getfile.dokpub.com/yandex/get/h … GSBCcdGy1g

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/lR7Kx5RiJeiI8g

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/nhG8vW4M2TGP1w

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/aO34EW5gW5SgkA

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/cOzdoGtRFC4DxA

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/6z4g6ENDzzGdfQ

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/6Jxr4m_wOAW5_A

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/bJTupRSaZiq17Q

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/EQ6Zy6blYdEpLQ

https://pics.meshok.net/pics/83468721.jpg

62

Re: Формы, механизмы, энергия наномира - 103

Формы, механизмы, энергия наномира. Сообщение 103 062

Сравниваем пропорции белка и ДНК

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/AqNvNU1_DMpjKg
Подробнее: http://nanoworld.org.ru/post/110347/#p110347

http://nanoworld88.narod.ru/data/248_files/0_5197a_14ad55f9_L.png
Подробнее: http://nanoworld88.narod.ru/data/248.htm

63

Re: Формы, механизмы, энергия наномира - 103

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_001: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://www.ncbi.nlm.nih.gov/protein/PK … TFVRRBH014

https://www.ncbi.nlm.nih.gov/nuccore/1305246555

https://www.ncbi.nlm.nih.gov/nuccore/PG … nd-gaps=on

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/RxKnNiwLVR-OUA

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/voS-Lo0tUv8Hew

Развернуть: https://yadi.sk/i/aIQaV0_t1jkFoA
Слушать(MIDI): https://yadi.sk/d/x5tpGbGLrtOGog

64

Re: Формы, механизмы, энергия наномира - 103

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_002: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/MLb9BMT3Umx7mg
Развернуть: https://yadi.sk/i/ySvxUHeNr34nbA
Слушать(MIDI): https://yadi.sk/d/Szpe04qVueMYbg

65

Re: Формы, механизмы, энергия наномира - 103

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_003: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/GVm5luR4f55v7g
Развернуть: https://yadi.sk/i/TsOOSpHVSR7xNw
Слушать(MIDI): https://yadi.sk/d/_Ifbzgo9J0VmWw

66

Re: Формы, механизмы, энергия наномира - 103

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_004: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://www.ncbi.nlm.nih.gov/nuccore/PG … nd-gaps=on

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/Mz6T1d2VoligAA
Развернуть: https://yadi.sk/i/bYyef3FC-vhIcw
Слушать(MIDI): https://yadi.sk/d/ks6qwoYGIihtfA

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_005: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://www.ncbi.nlm.nih.gov/protein/PK … TFVRRBH014

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/yF4whemjrPY5Qw

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/lBJ8kZiyPjYNbQ

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/6HUSYZ3OIdjQow

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/8oTVlq-8dwdJzg

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/YTEU2VFuJYi1LA

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/BpRIO3HupXLu0A

Кушелев: Punica granatum - даже не золотое, а бриллиантовое дно!

В одном геномном файле 6 "монстров белкового мира" подряд!

Нужно будет делать их 3D модели и настраивать по ним интерактивную версию Пикотех 3D. Скорее всего все эти белки работают с ДНК/РНК, а значит должны быть согласованы с ними по многим параметрам.

67

Re: Формы, механизмы, энергия наномира - 103

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_006: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://www.ncbi.nlm.nih.gov/protein/PK … TFVRRBH014

https://www.ncbi.nlm.nih.gov/nuccore/PG … nd-gaps=on

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/-YrG7YUWIhjy3A

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/d61Ll4lQLlIvvA
Продолжаем обриллианчивать человечество новыми научными открытиями...

68

Re: Формы, механизмы, энергия наномира - 103

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_007: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://www.ncbi.nlm.nih.gov/protein/PK … TFVRRBH014

https://www.ncbi.nlm.nih.gov/nuccore/PG … nd-gaps=on

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/nfmTWpEA3Dy3Aw

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/GQWGN27mYt_2uA

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/ZOGbm_M9Gjv5mQ

Кушелев: Информация к размышлению для тех, кто хочет обриллиантить человечество и, в том числе, себя smile

69

Re: Формы, механизмы, энергия наномира - 103

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_008: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://www.ncbi.nlm.nih.gov/nuccore/PG … nd-gaps=on

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/d32uiBmHe2dWZQ

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/PjGD_21sqMfgDA

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/GPSyk7lxKYUZ1A

Кушелев: Обриллиантим человечество вместе?

70

Re: Формы, механизмы, энергия наномира - 103

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-11-15_009: GRSKVGTQPRGRSNDGTRPYGRSKVGTPPCGRSNDGTRPY

https://www.ncbi.nlm.nih.gov/protein/PK … TFVRRBH014

https://www.ncbi.nlm.nih.gov/nuccore/PG … nd-gaps=on

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/ZumDr9x7xJfhBw