821

Re: Online service PROTEIN PICOTECHNOLOGY

Формы, механизмы, энергия наномира. Сообщение 98 017

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-04-23 001:

http://www.uniprot.org/uniprot/Q9QZ04.fasta

>sp|Q9QZ04|MAGL2_MOUSE MAGE-like protein 2 OS=Mus musculus OX=10090 GN=Magel2 PE=1 SV=2
MSQLSTNLGDSSPPESPVPAVHSRPTVLMRAPPASSRAPPVPWDPPPVDLQAPMAAWQAP
QPAWEAPEGQLPAPVAQLAQPPGLGAPMVQAPPLGGGMAKPPTPGVLMVHQPPPGAPMAQ
SSTPGVLMLHPSVTGAPLAHPPPPGTPMTHPPGTSMAHPPPPPPPPPPPPPPGTPMTHPP
PPGTPMGHHPPPGNPMTHPPPGNPMVHPLTHGAPMVHGGPHGTPMPHVPITGTPIAQQPT
PGVLMAQQLTPGVLMVQPPAPGAPMVQPPPQAALMTQPAPSITPMAKPPGPGVVMIHPPG
ARGPIIQTPVSGAPMAQTVLPPGQPLATWAPQGQPLILQIQSQVIRAPPQVPSVPQAPQV
QLATPPGWQATTPNWQVTPQGWPATPLTWQATQVTWQAPTIAWQATQPGRQGHSTIRTGH
TPIRPGPAPLLRQIPPMIRQIQPVMRQAPPLIRQVPIRPAPHGIASQPQLWQVLPPPPPL
RQAPQARLLLPRVPGTGQVSTVPPVAQIHLVPQSGPQVPQTVLPAQLSIPIPVPQAAAQS
APRTVHCPPIIWQAPKGQAPVPQELPVPQELPVPQELPVPQEVPVPQEIPVPQEIPVPQE
LPVPQELPVPQELPVPQELPVPQELPVPQELPVPQELPVPQELPVPLEFQEVQQAQAVGW
RAPKVPPHFWQPVSAQEAQEQATQIAHVEQQQPFQGAPASSKALQTQLPTHQAQASGLQA
ELPSVQLQPSWQGPLPMLQAQPGASATLANFPRGSTRSRMAPSGEPGPSSLEPRGPPRER
RAPARDKKGPPKERMFIGATFCAPRGASASRAYVPTAWKNLPATSETFPATSRVFPSTSH
FQPASSNAFRGPSAASESPKSLPFALQDPYACVEALPAVPWVPYPDGNASSACKSVPAIL
MVAAAAPQASATAAEASKSSEPPRRPGKATRKKKHLEPKEDNCGHRLSSRDWRGPRTWGN
PSHSDWEIQRAMQLLGDRESLYTPQGLNDWGCPNTSRMPRSLEGPSTSRDQEFCGDSGGS
QTWMASEVPSVSRGSSAAQEDPDRESQPLSPLDERANALVQFLLVKDQAKVPVQLSEMVN
VVIREYKDDSLDIINRANTKLECTFGCQLKEVDTKTHTYIIVNKMAYPQCNLLASYLERP
KFSLLMVVLSLIFMKGYCIRENLLFSFLFQLGLDVQETSGLFRITKKLITSVFVRHRYLE
YRQIPFTEPAEYELLWGPRAFLETNRVHILRFLAALYENQPQIWSCQYLDSLAELEYKDA
NAAAEESHDSDDDAHDPTSSPHPH

Кушелев: Тут уже видна повторяющаяся последовательность, т.е. похоже на наличие программной спирали.

https://www.ebi.ac.uk/ena/data/view/AJ2 … play=fasta

>ENA|AJ243608|AJ243608.1 Mus musculus mRNA for ns7 protein, ortholog of the human nM15 gene.
AACTCAGCTGCCGACCCACCAGGCCCAAGCCTCTGGCTTGCAGGCAGAACTGCCTTCAGT
GCAGCTGCAGCCTTCTTGGCAAGGCCCACTGCCCATGTTGCAGGCCCAGCCTGGAGCCTC
TGCCACACTGGCAAACTTTCCCCGGGGCTCCACTCGATCACGTATGGCTCCATCAGGAGA
ACCTGGCCCCTCTTCTCTAGAACCTCGGGGCCCTCCTAGGGAACGTAGGGCACCTGCAAG
GGACAAAAAGGGTCCTCCAAAAGAGCGCATGTTCATTGGTGCCACTTTCTGTGCTCCAAG
GGGGGCATCAGCATCCAGGGCATACGTGCCAACTGCCTGGAAAAACTTGCCTGCCACATC
AGAGACCTTTCCTGCCACCTCAAGGGTCTTTCCATCTACCTCTCATTTCCAGCCTGCCTC
TTCTAATGCCTTTAGAGGTCCATCTGCCGCCTCAGAGAGCCCAAAGTCACTGCCATTTGC
TCTGCAGGATCCTTATGCCTGCGTAGAGGCCCTGCCTGCAGTTCCCTGGGTTCCGTATCC
AGATGGAAATGCCTCATCAGCATGTAAGTCAGTGCCTGCCATCTTGATGGTGGCAGCAGC
TGCCCCCCAGGCAAGTGCCACTGCTGCAGAGGCCTCTAAGTCTTCAGAGCCGCCAAGACG
CCCCGGCAAAGCCACCAGGAAGAAGAAGCATCTGGAACCCAAAGAAGACAACTGTGGCCA
CAGGCTCTCCTCACGTGACTGGCGGGGGCCCCGAACCTGGGGCAATCCCAGTCATTCTGA
CTGGGAGATTCAGAGGGCTATGCAGCTCCTGGGGGACCGGGAATCCCTCTACACTCCGCA
GGGCCTGAATGACTGGGGGTGCCCCAACACTTCTAGGATGCCAAGGAGCTTGGAGGGCCC
TAGCACTTCACGGGACCAGGAATTCTGTGGTGACTCGGGTGGGTCTCAGACATGGATGGC
TTCTGAGGTCCCAAGCGTCTCTCGGGGATCCAGTGCTGCTCAGGAGGACCCTGATAGGGA
GAGTCAGCCCTTATCTCCCTTAGATGAGAGAGCAAACGCTTTGGTGCAGTTTCTCTTGGT
CAAAGACCAAGCCAAGGTGCCTGTCCAGCTCTCGGAGATGGTAAATGTTGTCATCCGAGA
ATACAAAGACGACAGCTTAGACATCATCAACCGTGCCAACACTAAGCTGGAGTGCACCTT
TGGTTGTCAACTGAAGGAAGTTGACACCAAAACCCACACTTACATCATCGTCAACAAGAT
GGCGTACCCTCAGTGTAATTTGCTGGCATCCTATTTAGAGAGGCCAAAGTTCAGCCTCCT
GATGGTGGTCTTGAGCCTCATCTTTATGAAAGGCTACTGTATCAGGGAGAATCTGCTCTT
TAGTTTTCTGTTCCAGCTAGGGCTGGATGTCCAGGAGACAAGTGGTCTCTTCAGAATTAC
AAAGAAGCTCATCACCAGTGTGTTTGTGAGACACAGGTACCTAGAGTACAGGCAAATCCC
GTTCACTGAGCCTGCAGAATACGAGCTTCTCTGGGGGCCCCGGGCATTCCTCGAAACCAA
CAGGGTGCACATCTTGAGATTTTTGGCCGCACTCTACGAGAACCAGCCCCAGATCTGGTC
ATGCCAGTACCTTGACTCACTGGCAGAGTTAGAATACAAGGACGCAAATGCCGCCGCCGA
AGAGTCCCATGACAGCGATGATGATGCCCACGACCCCACCAGCAGTCCCCATCCTCACTA
ATAGACGTTACTAAGATGATTTTTATACTTGTGGGTCCAAAGCCAAAGGCAAAAGACAAT
GGGGGGTGGGGGACATTGTGCTTTCTGGTGTTTTTTGGTATTGTTCTCTGTGTATAAATT
TTACAGCCTGTTTTTATATTTGCCAAAGCTTTTGTACAGTTTTGTGAAATGTTGATTTAA
ACTGGCTGCTGTATTGTTTTGTATTTTGGTGTCTGTATTTTTTTAAATGAGATCTGTGAT
TCCCTGTTTGGTGTACTAATTGTAATGTTACAGTATCAGAGTTGTGCTGCCTTGTGTGTG
AAAAGAAATGACAGTTTATTTGTCTCGTTTTGTTTATGTAAAATCAGAATGTTTTTGGAT
GTTAATATGACTCATCGGTAAAATACTGTCTGGAGAAAAGTAAAGATCAATACTATATAA
ATATACTTTTAGCATAAAAA

Этот файл ошибочный. Он кодирует стоп-кодоны в структуре белка.

Вот исправленный, сделанный вручную:

>ENA|AJ243608|AJ243608.1 Mus musculus mRNA for ns7 protein, ortholog of the human nM15 gene.
atgttcattggtgccactttctgtgctccaaggggggcatcagcatccagggcatacgt
gccaactgcctggaaaaacttgcctgccacatcagagacctttcctgccacctcaagggt
ctttccatctacctctcatttccagcctgcctcttctaatgcctttagaggtccatctgc
cgcctcagagagcccaaagtcactgccatttgctctgcaggatccttatgcctgcgtaga
ggccctgcctgcagttccctgggttccgtatccagatggaaatgcctcatcagcatgtaa
gtcagtgcctgccatcttgatggtggcagcagctgccccccaggcaagtgccactgctgc
agaggcctctaagtcttcagagccgccaagacgccccggcaaagccaccaggaagaagaa
gcatctggaacccaaagaagacaactgtggccacaggctctcctcacgtgactggcgggg
gccccgaacctggggcaatcccagtcattctgactgggagattcagagggctatgcagct
cctgggggaccgggaatccctctacactccgcagggcctgaatgactgggggtgccccaa
cacttctaggatgccaaggagcttggagggccctagcacttcacgggaccaggaattctg
tggtgactcgggtgggtctcagacatggatggcttctgaggtcccaagcgtctctcgggg
atccagtgctgctcaggaggaccctgatagggagagtcagcccttatctcccttagatga
gagagcaaacgctttggtgcagtttctcttggtcaaagaccaagccaaggtgcctgtcca
gctctcggagatggtaaatgttgtcatccgagaatacaaagacgacagcttagacatcat
caaccgtgccaacactaagctggagtgcacctttggttgtcaactgaaggaagttgacac
caaaacccacacttacatcatcgtcaacaagatggcgtaccctcagtgtaatttgctggc
atcctatttagagaggccaaagttcagcctcctgatggtggtcttgagcctcatctttat
gaaaggctactgtatcagggagaatctgctctttagttttctgttccagctagggctgga
tgtccaggagacaagtggtctcttcagaattacaaagaagctcatcaccagtgtgtttgt
gagacacaggtacctagagtacaggcaaatcccgttcactgagcctgcagaatacgagct
tctctgggggccccgggcattcctcgaaaccaacagggtgcacatcttgagatttttggc
cgcactctacgagaaccagccccagatctggtcatgccagtaccttgactcactggcaga
gttagaatacaaggacgcaaatgccgccgccgaagagtcccatgacagcgatgatgatgc
ccacgaccccaccagcagtccccatcctcactaat

https://img-fotki.yandex.ru/get/1003446/158289418.4ee/0_1911ac_db9a337f_orig.png
В этом белке попался семидольный ритм, но структура не периодическая...

822

Re: Online service PROTEIN PICOTECHNOLOGY

Формы, механизмы, энергия наномира - 98 029

Putin's Ruby Emdrive / Рубиновый Сармат / Satan-Ruby

Human Genome Protein Structure

Online service PROTEIN PICOTECHNOLOGY

Предложение для Курчатовского института.

Проверка таблицы композиционного генетического кода

Skype, 2018-04-24:

[23.04.2018 17:55:57] Кушелев Александр Юрьевич: Привет! Когда едем в Курчатовский?
[23.04.2018 18:06:58] Менеджер D: я сказал, что ты позвонишь завтра и проговоришь какие последовательности нужны. Набери её скажи, что вы договаривались с Менеджером D вернуться к этому разговору через неделю, поэтому я звоню
[23.04.2018 20:00:23] Кушелев Александр Юрьевич: ОК
[9:57:16] Кушелев Александр Юрьевич: Только что звонил в Курчатовский. Она сказала, что сейчас находится в командировке. Приедет на следующей неделе и займётся кодами.
[10:09:35] Менеджер D: Вот же, а ты уточнил дату?
[10:11:57] Кушелев Александр Юрьевич: Следующая неделя начинается с Пн. Вот я и позвоню в Пн. Если рано, она уточнит дату smile
[10:12:06] Менеджер D: хорошо
[10:12:06] Кушелев Александр Юрьевич: Зачем человека перенапрягать?
[10:12:28] Кушелев Александр Юрьевич: Я так понял, что они там все замотанные какие-то
[10:12:55] Менеджер D: Так там же Путин был
[10:15:40] Кушелев Александр Юрьевич: А...
[10:17:29] Кушелев Александр Юрьевич: Надо будет их спросить, не спрашивал ли Владимир Владимирович, как продвигается проверка Пикотехнологии? Ведь в декабре 2017 года я им послал письмо, где темой письма было: "Копия письма президенту РФ".

А вот и копия этого письма от 14 декабря 2017 года, зарегистрированного под номером ПГ 463:

Формы, механизмы, энергия наномира. Сообщение 93 581

Предложение для Курчатовского института.

Уважаемый президент России, Владимир Владимирович!
В лаборатории Наномир создана высокая технология двойного назначения "Пикотехнология белков", которая может многократно увеличить бюджет России. Она создана на базе научного открытия. Открыт композиционный генетический код, по которому не только выбираются аминокислоты при сборке белков, но и задаются их углы поворотов. Эта технология работает примерно в миллиард раз  быстрее рентгеноструктурного анализа, за который заказчики ежедневно платят примерно миллион евро. Новая технология проверена тремя независимыми методами:
1. Корреляция с рентгеноструктурным анализом.
2. Замыкание дисульфидных мостиков, определенных химическими методами
3. Обнаружение сверхдлинных спиралей белковых молекул.
Окончательную проверку новой технологии может сделать Курчатовский институт, в котором есть специализированная лаборатория рентгеноструктурного анализа.
Предложение для Курчатовского ин-та: http://nanoworld.org.ru/topic/1872/
Примите к сведению!
С уважением,
Александр Кушелев,
Руководитель лаборатории Наномир.

823

Re: Online service PROTEIN PICOTECHNOLOGY

Формы, механизмы, энергия наномира. Сообщение 100 281

Online service PROTEIN PICOTECHNOLOGY

Совершенствуем программу Пикотех-2D (8-я версия)

Пробный заказ 2018-07-17:

Обсуждение с программистом...

Skype, 2018-07-17:

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/y46y6dh03ZFpKf

[8:29:48] Кушелев Александр Юрьевич: Одиночные коды "2" превращаются в коды "8". И соответственно столбец 8var

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/0pqI6DcY3ZFry4

[8:33:22] Кушелев Александр Юрьевич: А здесь одиночные коды "2", т.е. уже "8" должны стать бледными.
[8:33:58] Кушелев Александр Юрьевич: Сейчас покажу, какими конкретно...

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/Gp5cnvoP3ZFp3n

[8:43:28] Кушелев Александр Юрьевич: color=[100, 255, 100]
[10:19:11] Инвестор V: Вижу.
[10:31:52] Кушелев Александр Юрьевич: Ура!

824

Re: Online service PROTEIN PICOTECHNOLOGY

Формы, механизмы, энергия наномира. Сообщение 100 277

Ответ из института белка

Совершенствуем программу Пикотех-2D (8-я версия)

Online service PROTEIN PICOTECHNOLOGY

Кушелев: Добрый день!
На Ваш вопрос о цене структуры белка специалист дал неожиданный ответ: "Для нас бесплатно". Это понятно, т.к. они сами вырастили кристаллы белков, а просвечивание кристалла рентгеном - это как на кнопку фотоаппарата нажать. В Курчатовском институте (г.Москва) бесплатно просвечивают рентгеном готовые кристаллы белка.
А реальную цену в Вашей стране легко узнать следующим образом. Нужно его спросить:
"Можете вырастить кристаллы этих двух белков, и сколько это будет стоить? Вторичная структура этих белков, определенная программой Пикотех, представлена в первых двух столбцах:

https://img-fotki.yandex.ru/get/879536/158289418.4a9/0_186fc0_a6332fad_orig.png
Нас интересуют кристаллы двух белков:
XM_022674627.1 и KGO44433

825

Re: Online service PROTEIN PICOTECHNOLOGY

Формы, механизмы, энергия наномира. Сообщение 101 202

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-09-04-001:

Ищем белок по нотам мелодии "Петушок погромче пой"

Слушать песню (на латвийском): https://yadi.sk/d/JXOoo26P04Gdsw

Ноты: EGFEEGFE

Аминокислотная последовательность: tqkttqkt

Один из белков, содержащих такую последовательность:

https://www.ncbi.nlm.nih.gov/protein/OG … WPG4F2N01R

ATP-dependent DNA helicase [Geobacteraceae bacterium GWC2_53_11]

Геном, содержащий, вероятно, программную спираль, музыка сборки которой легла в основу мелодии "Петушок погромче пой": https://www.ncbi.nlm.nih.gov/nuccore/1085230279

CDS             complement(1370..2773)
                     /protein_id="OGU13475.1"
                     /translation="MTQFQETETLELKKSTSELKEAVISIVAMLNKHQRGEVLFGVRN
                     DGAVAGQQVSDKTLRDISKAIADHIEPKIYPVVEHVAFDSKQCVKVRVEGKEHPYYAY
                     GRAYIRVGDEDRQLSARELEKLILEKNRDRLRWDTEVCTKATVDDIGPGKLKSFLKLS
                     GLKFDTIPNTLEKLNLVRDGKLLNAAVLCFARKPEKFFPNARLRCAVFGTLDTTFTIS
                     MQDFYGDVFYLIKKAEEYILEHINIGMRLDGMLRVDVPEIDPEAFREAIINAFCHRDY
                     REYDSVNIAIFKDRVEIRSPGLLYGGLTIASIRKKMVSSRRNELLAELFQRSHRIEKW
                     GRGIKMILEREPATEFEEIGTVQFIATFKRKNVEAVFSDSVGEKVGEKVGETSEKTTQ
                     KTTQKTTQKTTQKTTQKTTQKILELIAGNPKISRVELAAAIGITADGIKYQLDKMRKE
                     GMLKRIGPDKGGYWEIV"

                                                                                         t caaacaatct
     1381 cccaataccc gcccttatcc ggcccgatac gctttaacat cccttctttc ctcatcttgt
     1441 ccaactgata tttgataccg tctgcagtaa ttccaattgc tgcggctagc tcgacacggc
     1501 tgattttggg atttccggca atcagttcca gaattttctg ggtagttttc tgggtagttt
     1561 tctgggtagt tttctgggta gttttctggg tagttttctg ggtagttttc tccgaagttt
     1621 caccgacctt ttcaccgacc ttttcaccga cactgtcgct gaaaacagcc tcaacattct
     1681 tccgcttaaa agtggcaata aactgaaccg tgccgatttc ctcaaactcc gtcgccggtt
     1741 cccgttccag aatcatcttg atgccacggc cccatttctc gatacgatgg ctgcgctgga
     1801 acaactccgc cagcaattca ttacgccggg aagaaaccat tttcttcctg atagacgcaa
     1861 tggtcagccc accgtagagc aggccgggac tgcggatttc cacccgatcc ttgaaaatgg
     1921 cgatattgac cgaatcgtat tcccggtaat cccgatggca aaatgcgttg atgatcgcct
     1981 cacgaaacgc ctccgggtca atttcgggca catccacccg cagcatcccg tccaggcgca
     2041 taccgatgtt gatatgttcg agaatgtatt cctcggcttt tttgatcaga taaaagacat
     2101 cgccatagaa atcctgcata ctgatggtaa atgtggtatc caacgtcccg aacacggcgc
     2161 aacgcagccg ggcgttagga aagaactttt ccggtttgcg ggcaaaacag agcacggcgg
     2221 cgttcagcag tttgccgtct ctgaccagat tcagtttttc gagggtgttg gggatggtgt
     2281 cgaacttgag accactaagt ttcagaaagg atttcagctt gccagggccg atgtcgtcaa
     2341 cggtcgcctt ggtgcatacc tcggtatccc agcggagccg gtcacggttt ttctccagaa
     2401 tcagcttttc cagttcgcgg gcacttaact gccggtcttc atcgccaacc cggatatatg
     2461 ctcggccata ggcatagtag gggtgctcct tgccttcgac ccgtaccttg acgcattgtt
     2521 tggaatcaaa cgcaacgtgt tcgacaacgg ggtagatttt gggttcgatg tggtcggcaa
     2581 ttgccttgga aatatcgcgg agggttttat cggaaacctg ctgaccggca acagcgccgt
     2641 cgtttctgac gccgaacagt acttcgcccc gctggtgctt gttcagcata gccacaatcg
     2701 agatcaccgc ctccttcagt tcggaggtgg atttcttcaa ctcaagggtt tccgtttctt
     2761 gaaattgggt cat

Нуклеотидная последовательность в стандарте fasta:

>OGU13475
atgacccaatttcaagaaacggaaacccttgagttgaagaaatccacctccgaactgaag
gaggcggtgatctcgattgtggctatgctgaacaagcaccagcggggcgaagtactgttc
ggcgtcagaaacgacggcgctgttgccggtcagcaggtttccgataaaaccctccgcgat
atttccaaggcaattgccgaccacatcgaacccaaaatctaccccgttgtcgaacacgtt
gcgtttgattccaaacaatgcgtcaaggtacgggtcgaaggcaaggagcacccctactat
gcctatggccgagcatatatccgggttggcgatgaagaccggcagttaagtgcccgcgaa
ctggaaaagctgattctggagaaaaaccgtgaccggctccgctgggataccgaggtatgc
accaaggcgaccgttgacgacatcggccctggcaagctgaaatcctttctgaaacttagt
ggtctcaagttcgacaccatccccaacaccctcgaaaaactgaatctggtcagagacggc
aaactgctgaacgccgccgtgctctgttttgcccgcaaaccggaaaagttctttcctaac
gcccggctgcgttgcgccgtgttcgggacgttggataccacatttaccatcagtatgcag
gatttctatggcgatgtcttttatctgatcaaaaaagccgaggaatacattctcgaacat
atcaacatcggtatgcgcctggacgggatgctgcgggtggatgtgcccgaaattgacccg
gaggcgtttcgtgaggcgatcatcaacgcattttgccatcgggattaccgggaatacgat
tcggtcaatatcgccattttcaaggatcgggtggaaatccgcagtcccggcctgctctac
ggtgggctgaccattgcgtctatcaggaagaaaatggtttcttcccggcgtaatgaattg
ctggcggagttgttccagcgcagccatcgtatcgagaaatggggccgtggcatcaagatg
attctggaacgggaaccggcgacggagtttgaggaaatcggcacggttcagtttattgcc
acttttaagcggaagaatgttgaggctgttttcagcgacagtgtcggtgaaaaggtcggt
gaaaaggtcggtgaaacttcggagaaaactacccagaaaactacccagaaaactacccag
aaaactacccagaaaactacccagaaaactacccagaaaattctggaactgattgccgga
aatcccaaaatcagccgtgtcgagctagccgcagcaattggaattactgcagacggtatc
aaatatcagttggacaagatgaggaaagaagggatgttaaagcgtatcgggccggataag
ggcgggtattgggagattgtttga

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/rh-1HkZfUMvu9Q

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/at18JXiy63WDLw
Вторичная структура полностью: https://yadi.sk/i/Jq0A-RV9xILnPg

Под циклический фрагмент музыки "Петушок погромче пой" строится 6.5 периодов программной 5577-спирали.

Обратите внимание на то, что первый аминокислотный остаток отличается по химическому составу, но не по высоте ноты!

826

Re: Online service PROTEIN PICOTECHNOLOGY

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-09-04-002:

Ещё один белок, содержащий фрагмент, который строится под циклическую мелодию из песни "Петушок погромче пой".

https://www.ncbi.nlm.nih.gov/protein/XP … WPG4F2N01R

https://www.ncbi.nlm.nih.gov/nuccore/942128036

PREDICTED: Latimeria chalumnae otogelin (OTOG), mRNA

Файл в стандарте fasta:

>XM_014485269
atgaggtacggattacctttaaagaacaaatctagccttgttctcttgtctcatagcaag
aacaacagtgaaatactcaagaaatgggatactgcttcccaaggaaaacagggattagaa
acaactataactactttttcatctattgaaacacctcctgtggtgagaaaccttccagct
ttagtagaacaatctcctgatacttgctcagtaccatgtcttaatggtggcgaatgtaca
tatttggaccagtgcaactgcagccaatttaatgcacaaggatcaaggtgccaaacagtt
cccaacactggatatgaaagagacatgatctgtcggacatggggacagtacaattttgaa
acatttgatggactttactttaactttcctggaacatgtatgtatacacttgtgaaagac
tgtgatcaatctgaacccaccttcttagtacaggcttttccaggtcctggcgatgtccat
ttcaaaatttgtgctttggcaatgccatcacaccttgcagtggtggatgatttattctat
attcaagcctttgaggggctttttacctactggcagatggttcacaatgatccacaatgt
catttttcttcatcttcctgtcaacgttctgttagtttattcttttcgtctgcggaagaa
ataaggttaaaaggatctcaagtcacttgtaatggaatgagcatcacactgccatatact
tcccgcaaaataagggtagaaagaatagcagagcatgtattggttacacaccatcatata
tttattctggcttgggatggcaactcaggagtctatataaagatgaatccagagtatatt
ggtaagacatgtgggctatgtggaaacttcactggggacctacaggatgacctcttaacc
agcagcggtcttttaacagaagatattgcaacgtttgctaacagctggatggaaccatat
ccaaatgaatcttgtacatatgtaccaactaactatccatcaccttgctctacacaaagc
caagaaactctcaaggtaatatatactctatgtaatagactcctggaatcaccgttcata
aaatgccagtaccatgtgagcccctaccctttcctagcaagttgtacaaatgacctttgc
atgtctggtcctgaggatgtaattttgtgtcgagcactgaatgaatatgccagagcttgt
gcccaggcaggttatcctcttcatggctggagaagaaaaatccctcagtgtgcggtgggg
tgtgaaggagagcttatctatagggagtgtattagctgttgtccaagtttatgtcaccac
cacatgaaacagtgtttcgacagtgaactccagtgtcttgatgggtgttactgtcctgaa
gagttgatttatgagaatggaacctgcattaaaccctctgaatgcccatgtatgtttcat
gggatttcgtatgcaacaggctctgtggtacaagaagaatgcaacaactgcacttgtatg
ggaggaatatggaactgcacagacaacatttgtccagcggaatgctcagtaacaggggac
attcatttcatgacttttgatgggaagccatatacattccaggcaacgtgccagtacatt
ctggcaaagagtcgcagtagtggcaaatttactgttattcttcaaaacacagcttgtaga
gggaacttggatggctcctgcatccaatcagtgagtgttgttattgatcaagatcccaag
aagcaagtgacattgacacatacgggagaggtgtttgtctgtaatcagtacaaggtcaac
ctaccctacattgatggtttatttgaaattagacaactttcttcattgtttgtacaagta
aaaacaaagtttgggctgcaaatacaatatgacaaaggtgggcttcggctttaccttgta
gtggacggccaatggaaagatgacactgtggggctctgtggaaccttcaatgggaatatc
caagatgattttctatctcctgcaggagtgcctgaaagtattcctgaaatatttgccaac
tcctggaaaatttcatcagcttgtggttcaagcaagatcattccactgccagatccatgt
gatatacatcttcaggcagctccatatgcttcagaatcatgtagcgtcctcacaaaggat
atttttgctccatgtcaccaatacttgagcccaatttccttccatgagcagtgcaaatca
gatacctgtaaatgtggacagatatgtatgtgtgctgcacttgctcactatgctcgacag
tgcagaaaacatggagtaattatcgactttagaagaaatgttactgattgtgagctgagt
gcccttgtttctttatgggagaagtttactcacctggagctgcaggcattccaacttcag
gcctatggtactagttgcccaaatagtcaaacctattttaactgtagtgattcaatggaa
aatgatgagatgagcagaggaattgcttatgaaaagacctgtgagaatcagcttctcaac
atgaccttctctggagaagtcccctgcatttctgggtgtatttgtccaccaggttttatg
aaacatggtgatgagtgctttaaacctgacaactgtccctgcttctggaagggaaaggaa
tactttcctgaagacaaggtgacctctccctgctatacctgcatctgtcaacagggatca
tttcagtgcaccttccaaccctgtccgtcaacatgcacagcatacggagaccgtcattac
atgacttttgacggacttttgtttgatttcattggagcttgtaaagtttacttggttaag
agtaattcggatcctggtctatcggttattgctgaaaacatgaattgttataacactgga
attatttgcagaaagtttctacaaattaatgttggacgatcttttttagtatttgatgac
gacactggaattccaaacccatctagcttaatagacaaacagcaaaacgtacagatatgg
caagcaggattcttcaccattgttaattttcccaatgaaaatgttacaatcttgtgggat
cgaagaacaacagtgcatatccaagttggaccaaactggaagggtgagctattgggattg
tgtggaaattttgaccttaaaacaacaaatgaaatgcggactccagacaacattgagaca
gggaattcccaggagtttgggaatagctggtcagcagtagagtgtgtaaacagccctgat
atccagaatccatgcaacctgagtccattaagggaaccatatgccaagaaaaagtgtggg
atcttactgagtgaagtgtttgaagcctgccacccggtggttgatgttacctggtttcat
tcaaattgcctaacagacacatgtggctgtacccgtgggggtgattgtgagtgtttatgt
accagtgtgtcagcatacgcacaccgctgttgtcagcatgggattactgttgactggaga
tcccctactacttgcccttttgactgtgaatacttcaacaaatttctaggaaagggccct
tataaactggctgcttacttggatggtaaagcttttatggcagccaatctatctggtggt
attgttttcccagtaaagggagatgtctccattccaggaataagttttatgttgactcca
ggactgtataaacctaaagcatacgatactagcttgatttcctttgaagcagcagaaaga
cccaatttctttctacttttgggatccaatggttccctgttcctttcaaagtgggaagag
aatgaagagtttcaaacttcatctacatttatcttacacaaggatacctggattacagga
tacagttcttttgaatcatttaagaagcctggattcttcattcactacatgatatcctct
gtccatctgatgaaacatgaacacactgaaggatttcgacaatcttctcactttaggctc
attgaatctaattttagagctccagcacgctccacctgtgagtggagatatgacagctgt
gcaaccccatgtttcaagacctgccgagatcccacaggagaaaactgtgaaaccttacca
aaaatagaaggatgttttcctaaatgtccttcctacatggtactggacgaggttactatg
agatgcgtgtattttgaggactgcattaagccagcagttgttgttctaccttcacctcta
agtattacaacaataccacctgagcctgcctggaatctctctgttccagtactgtcaagt
acacactttgtttcagctactacaattccaagttcagccagtacatttaccacagttcta
aagctgaatactacaacacctcatgaagtttcaactgtatctatatcagaaaaaacactg
gcaacatctccagtaaaagttacagcctattcagtcaatatcacagctgctattcttcca
actacatcaccatatttgtctaaaactaccccttctataacagagtcaatgttgtcacca
tcagtagcaacaactgctcctaaagaaccagatacaactgctaaaacatctgcaaaggct
acttctagagaatttattaaaacaagtataccatacaaaactggaattacagaagtgagt
agtactgtgccatctcttgttaccacatctgtaactgacctatcacaagtaacttcaagc
aaaatggccataactgctgctgcaaccacagtgctgttcaagagagttacatcatcagca
attcctgaaacaataactacaccagagactggatcaaggatatttcccacaaaggaagtg
ccattaacaacacaaaaaactacacaaaaaccatatgtaattacagcatcaaattataca
gtacctacatcagtgcaagaaaaaaacctttctgctacaacatatccatcaaccacacat
atccctctccagtctactcagttaacatcaagtgtggtatatcccattttgacagaaatg
acttcatcatctttgacaatgtcacaagagcaaactaagtcattagaaacatcaactact
aaatatttatcaccaattgcaaatgcaacagagattacacttacgccttttacatggaaa
tcaacacctttaaatgttactgtatactcttcagttatgacaacccaaccatccactgct
tcctcatacccaacaacaaagcttaagacaacactaacacccataataacatcggaatca
acagttagaacagaatcagtaacagaaaaaacagagtactcaatgaaaaccgtaaaaaca
agcccagctgaaacattttcaacagaatttgtaaaaacaatttcagcttctaaagagtat
ccaagaactgtaccatatccaacaccagaacaaacaatttcattaaaaataacacccata
ggtgacactacctcaacagaaacacagtcagcgaccacaagatctcattatacaatggaa
aaacttttggaaacttcagcagtctctctcaaaacattaccaggtgcttggagtactaaa
gaaacctcaactgttttctatcctgagacgtcatcaattaaaaaaactttaaccaccaca
gcataccaaaccttaccagagacatcatcaatcactgttacatacccagtagctaaattc
agtacaataaggtctacagcaaaactgaccaccacatatccactatctgttggttcaact
actctttcagtctataatgttacattcagcactagatctcctacagaaattacagcagtg
tcatttacatcagctacaacagagacactgacttcttatccgcatacttctaaagaacat
actacagttttactttccacaggccagacaaggtttaaagaaacttcaccaccaaccatc
acccccttacttatatcacctatcacaaaaactacaactccaaaaacatcaaccgtaatt
tcattatcaccagagttaaatgtgactgcaggtgtgacatcaaatgagactgcagctaca
cagacatcagtagcaaaagccactataagttcaactacatctgctgtttcattatcacct
gcaatagctacatacacaaccctaagcaaagctacaagtgaaaaagtctcaactccatct
gcttctcttttaacatcagcctacagttcaactagctattctccagctataactagcagt
gtttctttcactacttcaagcccaatagtcaccacagaaaagctctctacaacaacaaaa
acctttactagcactgtgctttcaacaactgcaaccagccatgtcgaagcacatgttcct
gagactacaaaagaattaccattttcagagttttcaactgtgacactcgctccttcagtg
ccaagctcattacttcctactaagtactggactacagtgcccaaagaaacctctcgaaat
atgactgtacctaccacaaagaatctaacatctataagtattactcaacctgttcaggtt
tcaacatcaactgaagttacacttgaagctatgacaggtgcaacatttatgtcaactagt
tcctacataaaaaatgtgacctctcaatcaacccaaacttgcacagttccatttcctgaa
tatcctgatccttgcattgaatatttctgtgtgaatggccacttgattaaacacaataaa
actcaaacctgtccctataatgcaactgcacctacttgtggactaatgggacttgcactg
gaggttaatggagataagtgttgtccaaaatgggaatgcccatgtcaatgcaccatttat
agtgatctaagattgatgacctttgatggaagcaacttgggtatctttaaagcagcttca
tatattattactcacgtacagcaggaaatcataaccatcaaaacacaaaactgccagaac
ttaatgggggactacaggaactcaatcaagctatgcctggcaaccctcaacataacccat
ccaactcttctttttagcatcgatcgcctgaaaagaaaactatttgtgaattcaacatct
gtcagctctaaatacagaaaaaatggatttatgattatggatactggtcatatgtatttg
atcaaaacaccagctggaataaagataaaatggtttcacaacaccggaatgatgacaata
gagaccaatacctccagtaaattaacaaccatgggattgtgtggttactgtgatagaaac
caaacaaatgactttacactactgaatggtacagttcttagtgaaggggagaacccaaca
accttcatggacagctggcaagtgccaaatactttacgttatgtgggagaggatcggcgg
cgtgacgttaactgttcaaccagtgactgctctgagtgtttcagcatgctttataaccaa
accttcagcagctgccatccctttgtttctcctgaggtgttttgtgaaatctggatacaa
gatgaagaatatgtgaaaaatccttgtatagcactggctgcatatgtagcaacttgtcaa
aagtttaatatctgcataaaatggaggacttcagactactgctccttccattgccctcaa
gatttaaggtatcaagcttgtttgccagtgtgcaatgcaaaaacctgccagaactatgat
ttagagcatctggatgttcaagaatgctcaggactaagtgaaggctgtgtctgtccagaa
gggactgttcttcatcgttcctattctgatctctgtatcccagaggaaaagtgtgcctgc
actgacagtttcggaaccccacgagctccaggggagacatggaccacgtcaccagatagc
tgttgtacatacacgtgcataggcaatgataccattattccagtggaacataactgctct
gatgttatagaaccagaatgcaggcatggtgaagaagtggtaataatcctgtctgatgac
aaaagctgctgtcctcaaaaaacatgtatttgcaaccagacaatttgtgaaagttatatt
cctcagtgtagcgatgaagaaaaacttattcttaactataaggcagactcttgctgtcca
gaatatatttgtgtgtgtgctgcttgctctgacaatattccaaaatgtcaagatggagaa
attcttattgtggatggtaataccacagatagatgctgtcctggataccagtgcgtttgt
gaaacgcatcgctgtcctgagtacaactgttctttaggaaaagcaataatcgaagcatgg
agtccagagcaatgttgcccatataaaacatgtgtgtgtgcatgtgagacaattcctaaa
cccaattgcaaactgggagaagcaatacaaatagatgaagaattccaaaatgaccctgaa
aatcaatgtggttgcattaaatacaaatgtgtaaagaaccaggtgtgtgtagatgaagag
agaggtgtcttgcatccaggacagactattgtggaacatactcctaatggcttttgccat
attacccattgtactagccagactgatccacaaaccaactattaccagattagtgttaaa
agaataaactgtactgcaacgtgtcaatcaaaccaaaaatatgagcctcctgttgattta
acaacttgctgcggaatctgtaaaaatgtgacatgtctccacactatagaaaatggtaca
gttaaagcttatgagcctggcacctcttggatatcaaattgtgttagatatggatgcaca
gacacaatgttaggacctgttctaactgcatctccaattagctgtcctccctttaatgaa
actgaatgcctgaagatagggggaactattgtgcccttcatggatggatgctgtaagagc
tgtaaagaagatgcaaagttctgtcagaaagtgaccgtaaggatgaaaattcgaaagaat
gactgtaaaagtaatataccaattaacattgtttcatgtgatgggaaatgtccttctgcc
agtatttataattacaatattaacacatatgccaggttctgcaagtgctgcagggaaact
gggctgcaaacacgtactgtacagctattctgtagtggcaactcaacttgggtcagttat
tccatccaggagcccacagattgttcttgccagtggtcctag

Вторичная структура:

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/fVNdwa9JXKFmEg

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/GLPcON4dAZDC2g

Кушелев: Любопытная структура...

Здесь последовательность TTQKTTQK не образует периодической вторичной структуры.