821

Re: Online service PROTEIN PICOTECHNOLOGY

Формы, механизмы, энергия наномира. Сообщение 98 017

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-04-23 001:

http://www.uniprot.org/uniprot/Q9QZ04.fasta

>sp|Q9QZ04|MAGL2_MOUSE MAGE-like protein 2 OS=Mus musculus OX=10090 GN=Magel2 PE=1 SV=2
MSQLSTNLGDSSPPESPVPAVHSRPTVLMRAPPASSRAPPVPWDPPPVDLQAPMAAWQAP
QPAWEAPEGQLPAPVAQLAQPPGLGAPMVQAPPLGGGMAKPPTPGVLMVHQPPPGAPMAQ
SSTPGVLMLHPSVTGAPLAHPPPPGTPMTHPPGTSMAHPPPPPPPPPPPPPPGTPMTHPP
PPGTPMGHHPPPGNPMTHPPPGNPMVHPLTHGAPMVHGGPHGTPMPHVPITGTPIAQQPT
PGVLMAQQLTPGVLMVQPPAPGAPMVQPPPQAALMTQPAPSITPMAKPPGPGVVMIHPPG
ARGPIIQTPVSGAPMAQTVLPPGQPLATWAPQGQPLILQIQSQVIRAPPQVPSVPQAPQV
QLATPPGWQATTPNWQVTPQGWPATPLTWQATQVTWQAPTIAWQATQPGRQGHSTIRTGH
TPIRPGPAPLLRQIPPMIRQIQPVMRQAPPLIRQVPIRPAPHGIASQPQLWQVLPPPPPL
RQAPQARLLLPRVPGTGQVSTVPPVAQIHLVPQSGPQVPQTVLPAQLSIPIPVPQAAAQS
APRTVHCPPIIWQAPKGQAPVPQELPVPQELPVPQELPVPQEVPVPQEIPVPQEIPVPQE
LPVPQELPVPQELPVPQELPVPQELPVPQELPVPQELPVPQELPVPLEFQEVQQAQAVGW
RAPKVPPHFWQPVSAQEAQEQATQIAHVEQQQPFQGAPASSKALQTQLPTHQAQASGLQA
ELPSVQLQPSWQGPLPMLQAQPGASATLANFPRGSTRSRMAPSGEPGPSSLEPRGPPRER
RAPARDKKGPPKERMFIGATFCAPRGASASRAYVPTAWKNLPATSETFPATSRVFPSTSH
FQPASSNAFRGPSAASESPKSLPFALQDPYACVEALPAVPWVPYPDGNASSACKSVPAIL
MVAAAAPQASATAAEASKSSEPPRRPGKATRKKKHLEPKEDNCGHRLSSRDWRGPRTWGN
PSHSDWEIQRAMQLLGDRESLYTPQGLNDWGCPNTSRMPRSLEGPSTSRDQEFCGDSGGS
QTWMASEVPSVSRGSSAAQEDPDRESQPLSPLDERANALVQFLLVKDQAKVPVQLSEMVN
VVIREYKDDSLDIINRANTKLECTFGCQLKEVDTKTHTYIIVNKMAYPQCNLLASYLERP
KFSLLMVVLSLIFMKGYCIRENLLFSFLFQLGLDVQETSGLFRITKKLITSVFVRHRYLE
YRQIPFTEPAEYELLWGPRAFLETNRVHILRFLAALYENQPQIWSCQYLDSLAELEYKDA
NAAAEESHDSDDDAHDPTSSPHPH

Кушелев: Тут уже видна повторяющаяся последовательность, т.е. похоже на наличие программной спирали.

https://www.ebi.ac.uk/ena/data/view/AJ2 … play=fasta

>ENA|AJ243608|AJ243608.1 Mus musculus mRNA for ns7 protein, ortholog of the human nM15 gene.
AACTCAGCTGCCGACCCACCAGGCCCAAGCCTCTGGCTTGCAGGCAGAACTGCCTTCAGT
GCAGCTGCAGCCTTCTTGGCAAGGCCCACTGCCCATGTTGCAGGCCCAGCCTGGAGCCTC
TGCCACACTGGCAAACTTTCCCCGGGGCTCCACTCGATCACGTATGGCTCCATCAGGAGA
ACCTGGCCCCTCTTCTCTAGAACCTCGGGGCCCTCCTAGGGAACGTAGGGCACCTGCAAG
GGACAAAAAGGGTCCTCCAAAAGAGCGCATGTTCATTGGTGCCACTTTCTGTGCTCCAAG
GGGGGCATCAGCATCCAGGGCATACGTGCCAACTGCCTGGAAAAACTTGCCTGCCACATC
AGAGACCTTTCCTGCCACCTCAAGGGTCTTTCCATCTACCTCTCATTTCCAGCCTGCCTC
TTCTAATGCCTTTAGAGGTCCATCTGCCGCCTCAGAGAGCCCAAAGTCACTGCCATTTGC
TCTGCAGGATCCTTATGCCTGCGTAGAGGCCCTGCCTGCAGTTCCCTGGGTTCCGTATCC
AGATGGAAATGCCTCATCAGCATGTAAGTCAGTGCCTGCCATCTTGATGGTGGCAGCAGC
TGCCCCCCAGGCAAGTGCCACTGCTGCAGAGGCCTCTAAGTCTTCAGAGCCGCCAAGACG
CCCCGGCAAAGCCACCAGGAAGAAGAAGCATCTGGAACCCAAAGAAGACAACTGTGGCCA
CAGGCTCTCCTCACGTGACTGGCGGGGGCCCCGAACCTGGGGCAATCCCAGTCATTCTGA
CTGGGAGATTCAGAGGGCTATGCAGCTCCTGGGGGACCGGGAATCCCTCTACACTCCGCA
GGGCCTGAATGACTGGGGGTGCCCCAACACTTCTAGGATGCCAAGGAGCTTGGAGGGCCC
TAGCACTTCACGGGACCAGGAATTCTGTGGTGACTCGGGTGGGTCTCAGACATGGATGGC
TTCTGAGGTCCCAAGCGTCTCTCGGGGATCCAGTGCTGCTCAGGAGGACCCTGATAGGGA
GAGTCAGCCCTTATCTCCCTTAGATGAGAGAGCAAACGCTTTGGTGCAGTTTCTCTTGGT
CAAAGACCAAGCCAAGGTGCCTGTCCAGCTCTCGGAGATGGTAAATGTTGTCATCCGAGA
ATACAAAGACGACAGCTTAGACATCATCAACCGTGCCAACACTAAGCTGGAGTGCACCTT
TGGTTGTCAACTGAAGGAAGTTGACACCAAAACCCACACTTACATCATCGTCAACAAGAT
GGCGTACCCTCAGTGTAATTTGCTGGCATCCTATTTAGAGAGGCCAAAGTTCAGCCTCCT
GATGGTGGTCTTGAGCCTCATCTTTATGAAAGGCTACTGTATCAGGGAGAATCTGCTCTT
TAGTTTTCTGTTCCAGCTAGGGCTGGATGTCCAGGAGACAAGTGGTCTCTTCAGAATTAC
AAAGAAGCTCATCACCAGTGTGTTTGTGAGACACAGGTACCTAGAGTACAGGCAAATCCC
GTTCACTGAGCCTGCAGAATACGAGCTTCTCTGGGGGCCCCGGGCATTCCTCGAAACCAA
CAGGGTGCACATCTTGAGATTTTTGGCCGCACTCTACGAGAACCAGCCCCAGATCTGGTC
ATGCCAGTACCTTGACTCACTGGCAGAGTTAGAATACAAGGACGCAAATGCCGCCGCCGA
AGAGTCCCATGACAGCGATGATGATGCCCACGACCCCACCAGCAGTCCCCATCCTCACTA
ATAGACGTTACTAAGATGATTTTTATACTTGTGGGTCCAAAGCCAAAGGCAAAAGACAAT
GGGGGGTGGGGGACATTGTGCTTTCTGGTGTTTTTTGGTATTGTTCTCTGTGTATAAATT
TTACAGCCTGTTTTTATATTTGCCAAAGCTTTTGTACAGTTTTGTGAAATGTTGATTTAA
ACTGGCTGCTGTATTGTTTTGTATTTTGGTGTCTGTATTTTTTTAAATGAGATCTGTGAT
TCCCTGTTTGGTGTACTAATTGTAATGTTACAGTATCAGAGTTGTGCTGCCTTGTGTGTG
AAAAGAAATGACAGTTTATTTGTCTCGTTTTGTTTATGTAAAATCAGAATGTTTTTGGAT
GTTAATATGACTCATCGGTAAAATACTGTCTGGAGAAAAGTAAAGATCAATACTATATAA
ATATACTTTTAGCATAAAAA

Этот файл ошибочный. Он кодирует стоп-кодоны в структуре белка.

Вот исправленный, сделанный вручную:

>ENA|AJ243608|AJ243608.1 Mus musculus mRNA for ns7 protein, ortholog of the human nM15 gene.
atgttcattggtgccactttctgtgctccaaggggggcatcagcatccagggcatacgt
gccaactgcctggaaaaacttgcctgccacatcagagacctttcctgccacctcaagggt
ctttccatctacctctcatttccagcctgcctcttctaatgcctttagaggtccatctgc
cgcctcagagagcccaaagtcactgccatttgctctgcaggatccttatgcctgcgtaga
ggccctgcctgcagttccctgggttccgtatccagatggaaatgcctcatcagcatgtaa
gtcagtgcctgccatcttgatggtggcagcagctgccccccaggcaagtgccactgctgc
agaggcctctaagtcttcagagccgccaagacgccccggcaaagccaccaggaagaagaa
gcatctggaacccaaagaagacaactgtggccacaggctctcctcacgtgactggcgggg
gccccgaacctggggcaatcccagtcattctgactgggagattcagagggctatgcagct
cctgggggaccgggaatccctctacactccgcagggcctgaatgactgggggtgccccaa
cacttctaggatgccaaggagcttggagggccctagcacttcacgggaccaggaattctg
tggtgactcgggtgggtctcagacatggatggcttctgaggtcccaagcgtctctcgggg
atccagtgctgctcaggaggaccctgatagggagagtcagcccttatctcccttagatga
gagagcaaacgctttggtgcagtttctcttggtcaaagaccaagccaaggtgcctgtcca
gctctcggagatggtaaatgttgtcatccgagaatacaaagacgacagcttagacatcat
caaccgtgccaacactaagctggagtgcacctttggttgtcaactgaaggaagttgacac
caaaacccacacttacatcatcgtcaacaagatggcgtaccctcagtgtaatttgctggc
atcctatttagagaggccaaagttcagcctcctgatggtggtcttgagcctcatctttat
gaaaggctactgtatcagggagaatctgctctttagttttctgttccagctagggctgga
tgtccaggagacaagtggtctcttcagaattacaaagaagctcatcaccagtgtgtttgt
gagacacaggtacctagagtacaggcaaatcccgttcactgagcctgcagaatacgagct
tctctgggggccccgggcattcctcgaaaccaacagggtgcacatcttgagatttttggc
cgcactctacgagaaccagccccagatctggtcatgccagtaccttgactcactggcaga
gttagaatacaaggacgcaaatgccgccgccgaagagtcccatgacagcgatgatgatgc
ccacgaccccaccagcagtccccatcctcactaat

https://img-fotki.yandex.ru/get/1003446/158289418.4ee/0_1911ac_db9a337f_orig.png
В этом белке попался семидольный ритм, но структура не периодическая...

822

Re: Online service PROTEIN PICOTECHNOLOGY

Формы, механизмы, энергия наномира - 98 029

Putin's Ruby Emdrive / Рубиновый Сармат / Satan-Ruby

Human Genome Protein Structure

Online service PROTEIN PICOTECHNOLOGY

Предложение для Курчатовского института.

Проверка таблицы композиционного генетического кода

Skype, 2018-04-24:

[23.04.2018 17:55:57] Кушелев Александр Юрьевич: Привет! Когда едем в Курчатовский?
[23.04.2018 18:06:58] Менеджер D: я сказал, что ты позвонишь завтра и проговоришь какие последовательности нужны. Набери её скажи, что вы договаривались с Менеджером D вернуться к этому разговору через неделю, поэтому я звоню
[23.04.2018 20:00:23] Кушелев Александр Юрьевич: ОК
[9:57:16] Кушелев Александр Юрьевич: Только что звонил в Курчатовский. Она сказала, что сейчас находится в командировке. Приедет на следующей неделе и займётся кодами.
[10:09:35] Менеджер D: Вот же, а ты уточнил дату?
[10:11:57] Кушелев Александр Юрьевич: Следующая неделя начинается с Пн. Вот я и позвоню в Пн. Если рано, она уточнит дату smile
[10:12:06] Менеджер D: хорошо
[10:12:06] Кушелев Александр Юрьевич: Зачем человека перенапрягать?
[10:12:28] Кушелев Александр Юрьевич: Я так понял, что они там все замотанные какие-то
[10:12:55] Менеджер D: Так там же Путин был
[10:15:40] Кушелев Александр Юрьевич: А...
[10:17:29] Кушелев Александр Юрьевич: Надо будет их спросить, не спрашивал ли Владимир Владимирович, как продвигается проверка Пикотехнологии? Ведь в декабре 2017 года я им послал письмо, где темой письма было: "Копия письма президенту РФ".

А вот и копия этого письма от 14 декабря 2017 года, зарегистрированного под номером ПГ 463:

Формы, механизмы, энергия наномира. Сообщение 93 581

Предложение для Курчатовского института.

Уважаемый президент России, Владимир Владимирович!
В лаборатории Наномир создана высокая технология двойного назначения "Пикотехнология белков", которая может многократно увеличить бюджет России. Она создана на базе научного открытия. Открыт композиционный генетический код, по которому не только выбираются аминокислоты при сборке белков, но и задаются их углы поворотов. Эта технология работает примерно в миллиард раз  быстрее рентгеноструктурного анализа, за который заказчики ежедневно платят примерно миллион евро. Новая технология проверена тремя независимыми методами:
1. Корреляция с рентгеноструктурным анализом.
2. Замыкание дисульфидных мостиков, определенных химическими методами
3. Обнаружение сверхдлинных спиралей белковых молекул.
Окончательную проверку новой технологии может сделать Курчатовский институт, в котором есть специализированная лаборатория рентгеноструктурного анализа.
Предложение для Курчатовского ин-та: http://nanoworld.org.ru/topic/1872/
Примите к сведению!
С уважением,
Александр Кушелев,
Руководитель лаборатории Наномир.

823

Re: Online service PROTEIN PICOTECHNOLOGY

Формы, механизмы, энергия наномира. Сообщение 100 281

Online service PROTEIN PICOTECHNOLOGY

Совершенствуем программу Пикотех-2D (8-я версия)

Пробный заказ 2018-07-17:

Обсуждение с программистом...

Skype, 2018-07-17:

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/y46y6dh03ZFpKf

[8:29:48] Кушелев Александр Юрьевич: Одиночные коды "2" превращаются в коды "8". И соответственно столбец 8var

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/0pqI6DcY3ZFry4

[8:33:22] Кушелев Александр Юрьевич: А здесь одиночные коды "2", т.е. уже "8" должны стать бледными.
[8:33:58] Кушелев Александр Юрьевич: Сейчас покажу, какими конкретно...

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/Gp5cnvoP3ZFp3n

[8:43:28] Кушелев Александр Юрьевич: color=[100, 255, 100]
[10:19:11] Инвестор V: Вижу.
[10:31:52] Кушелев Александр Юрьевич: Ура!

824

Re: Online service PROTEIN PICOTECHNOLOGY

Формы, механизмы, энергия наномира. Сообщение 100 277

Ответ из института белка

Совершенствуем программу Пикотех-2D (8-я версия)

Online service PROTEIN PICOTECHNOLOGY

Кушелев: Добрый день!
На Ваш вопрос о цене структуры белка специалист дал неожиданный ответ: "Для нас бесплатно". Это понятно, т.к. они сами вырастили кристаллы белков, а просвечивание кристалла рентгеном - это как на кнопку фотоаппарата нажать. В Курчатовском институте (г.Москва) бесплатно просвечивают рентгеном готовые кристаллы белка.
А реальную цену в Вашей стране легко узнать следующим образом. Нужно его спросить:
"Можете вырастить кристаллы этих двух белков, и сколько это будет стоить? Вторичная структура этих белков, определенная программой Пикотех, представлена в первых двух столбцах:

https://img-fotki.yandex.ru/get/879536/158289418.4a9/0_186fc0_a6332fad_orig.png
Нас интересуют кристаллы двух белков:
XM_022674627.1 и KGO44433