821

Re: Online service PROTEIN PICOTECHNOLOGY

Формы, механизмы, энергия наномира. Сообщение 98 017

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-04-23 001:

http://www.uniprot.org/uniprot/Q9QZ04.fasta

>sp|Q9QZ04|MAGL2_MOUSE MAGE-like protein 2 OS=Mus musculus OX=10090 GN=Magel2 PE=1 SV=2
MSQLSTNLGDSSPPESPVPAVHSRPTVLMRAPPASSRAPPVPWDPPPVDLQAPMAAWQAP
QPAWEAPEGQLPAPVAQLAQPPGLGAPMVQAPPLGGGMAKPPTPGVLMVHQPPPGAPMAQ
SSTPGVLMLHPSVTGAPLAHPPPPGTPMTHPPGTSMAHPPPPPPPPPPPPPPGTPMTHPP
PPGTPMGHHPPPGNPMTHPPPGNPMVHPLTHGAPMVHGGPHGTPMPHVPITGTPIAQQPT
PGVLMAQQLTPGVLMVQPPAPGAPMVQPPPQAALMTQPAPSITPMAKPPGPGVVMIHPPG
ARGPIIQTPVSGAPMAQTVLPPGQPLATWAPQGQPLILQIQSQVIRAPPQVPSVPQAPQV
QLATPPGWQATTPNWQVTPQGWPATPLTWQATQVTWQAPTIAWQATQPGRQGHSTIRTGH
TPIRPGPAPLLRQIPPMIRQIQPVMRQAPPLIRQVPIRPAPHGIASQPQLWQVLPPPPPL
RQAPQARLLLPRVPGTGQVSTVPPVAQIHLVPQSGPQVPQTVLPAQLSIPIPVPQAAAQS
APRTVHCPPIIWQAPKGQAPVPQELPVPQELPVPQELPVPQEVPVPQEIPVPQEIPVPQE
LPVPQELPVPQELPVPQELPVPQELPVPQELPVPQELPVPQELPVPLEFQEVQQAQAVGW
RAPKVPPHFWQPVSAQEAQEQATQIAHVEQQQPFQGAPASSKALQTQLPTHQAQASGLQA
ELPSVQLQPSWQGPLPMLQAQPGASATLANFPRGSTRSRMAPSGEPGPSSLEPRGPPRER
RAPARDKKGPPKERMFIGATFCAPRGASASRAYVPTAWKNLPATSETFPATSRVFPSTSH
FQPASSNAFRGPSAASESPKSLPFALQDPYACVEALPAVPWVPYPDGNASSACKSVPAIL
MVAAAAPQASATAAEASKSSEPPRRPGKATRKKKHLEPKEDNCGHRLSSRDWRGPRTWGN
PSHSDWEIQRAMQLLGDRESLYTPQGLNDWGCPNTSRMPRSLEGPSTSRDQEFCGDSGGS
QTWMASEVPSVSRGSSAAQEDPDRESQPLSPLDERANALVQFLLVKDQAKVPVQLSEMVN
VVIREYKDDSLDIINRANTKLECTFGCQLKEVDTKTHTYIIVNKMAYPQCNLLASYLERP
KFSLLMVVLSLIFMKGYCIRENLLFSFLFQLGLDVQETSGLFRITKKLITSVFVRHRYLE
YRQIPFTEPAEYELLWGPRAFLETNRVHILRFLAALYENQPQIWSCQYLDSLAELEYKDA
NAAAEESHDSDDDAHDPTSSPHPH

Кушелев: Тут уже видна повторяющаяся последовательность, т.е. похоже на наличие программной спирали.

https://www.ebi.ac.uk/ena/data/view/AJ2 … play=fasta

>ENA|AJ243608|AJ243608.1 Mus musculus mRNA for ns7 protein, ortholog of the human nM15 gene.
AACTCAGCTGCCGACCCACCAGGCCCAAGCCTCTGGCTTGCAGGCAGAACTGCCTTCAGT
GCAGCTGCAGCCTTCTTGGCAAGGCCCACTGCCCATGTTGCAGGCCCAGCCTGGAGCCTC
TGCCACACTGGCAAACTTTCCCCGGGGCTCCACTCGATCACGTATGGCTCCATCAGGAGA
ACCTGGCCCCTCTTCTCTAGAACCTCGGGGCCCTCCTAGGGAACGTAGGGCACCTGCAAG
GGACAAAAAGGGTCCTCCAAAAGAGCGCATGTTCATTGGTGCCACTTTCTGTGCTCCAAG
GGGGGCATCAGCATCCAGGGCATACGTGCCAACTGCCTGGAAAAACTTGCCTGCCACATC
AGAGACCTTTCCTGCCACCTCAAGGGTCTTTCCATCTACCTCTCATTTCCAGCCTGCCTC
TTCTAATGCCTTTAGAGGTCCATCTGCCGCCTCAGAGAGCCCAAAGTCACTGCCATTTGC
TCTGCAGGATCCTTATGCCTGCGTAGAGGCCCTGCCTGCAGTTCCCTGGGTTCCGTATCC
AGATGGAAATGCCTCATCAGCATGTAAGTCAGTGCCTGCCATCTTGATGGTGGCAGCAGC
TGCCCCCCAGGCAAGTGCCACTGCTGCAGAGGCCTCTAAGTCTTCAGAGCCGCCAAGACG
CCCCGGCAAAGCCACCAGGAAGAAGAAGCATCTGGAACCCAAAGAAGACAACTGTGGCCA
CAGGCTCTCCTCACGTGACTGGCGGGGGCCCCGAACCTGGGGCAATCCCAGTCATTCTGA
CTGGGAGATTCAGAGGGCTATGCAGCTCCTGGGGGACCGGGAATCCCTCTACACTCCGCA
GGGCCTGAATGACTGGGGGTGCCCCAACACTTCTAGGATGCCAAGGAGCTTGGAGGGCCC
TAGCACTTCACGGGACCAGGAATTCTGTGGTGACTCGGGTGGGTCTCAGACATGGATGGC
TTCTGAGGTCCCAAGCGTCTCTCGGGGATCCAGTGCTGCTCAGGAGGACCCTGATAGGGA
GAGTCAGCCCTTATCTCCCTTAGATGAGAGAGCAAACGCTTTGGTGCAGTTTCTCTTGGT
CAAAGACCAAGCCAAGGTGCCTGTCCAGCTCTCGGAGATGGTAAATGTTGTCATCCGAGA
ATACAAAGACGACAGCTTAGACATCATCAACCGTGCCAACACTAAGCTGGAGTGCACCTT
TGGTTGTCAACTGAAGGAAGTTGACACCAAAACCCACACTTACATCATCGTCAACAAGAT
GGCGTACCCTCAGTGTAATTTGCTGGCATCCTATTTAGAGAGGCCAAAGTTCAGCCTCCT
GATGGTGGTCTTGAGCCTCATCTTTATGAAAGGCTACTGTATCAGGGAGAATCTGCTCTT
TAGTTTTCTGTTCCAGCTAGGGCTGGATGTCCAGGAGACAAGTGGTCTCTTCAGAATTAC
AAAGAAGCTCATCACCAGTGTGTTTGTGAGACACAGGTACCTAGAGTACAGGCAAATCCC
GTTCACTGAGCCTGCAGAATACGAGCTTCTCTGGGGGCCCCGGGCATTCCTCGAAACCAA
CAGGGTGCACATCTTGAGATTTTTGGCCGCACTCTACGAGAACCAGCCCCAGATCTGGTC
ATGCCAGTACCTTGACTCACTGGCAGAGTTAGAATACAAGGACGCAAATGCCGCCGCCGA
AGAGTCCCATGACAGCGATGATGATGCCCACGACCCCACCAGCAGTCCCCATCCTCACTA
ATAGACGTTACTAAGATGATTTTTATACTTGTGGGTCCAAAGCCAAAGGCAAAAGACAAT
GGGGGGTGGGGGACATTGTGCTTTCTGGTGTTTTTTGGTATTGTTCTCTGTGTATAAATT
TTACAGCCTGTTTTTATATTTGCCAAAGCTTTTGTACAGTTTTGTGAAATGTTGATTTAA
ACTGGCTGCTGTATTGTTTTGTATTTTGGTGTCTGTATTTTTTTAAATGAGATCTGTGAT
TCCCTGTTTGGTGTACTAATTGTAATGTTACAGTATCAGAGTTGTGCTGCCTTGTGTGTG
AAAAGAAATGACAGTTTATTTGTCTCGTTTTGTTTATGTAAAATCAGAATGTTTTTGGAT
GTTAATATGACTCATCGGTAAAATACTGTCTGGAGAAAAGTAAAGATCAATACTATATAA
ATATACTTTTAGCATAAAAA

Этот файл ошибочный. Он кодирует стоп-кодоны в структуре белка.

Вот исправленный, сделанный вручную:

>ENA|AJ243608|AJ243608.1 Mus musculus mRNA for ns7 protein, ortholog of the human nM15 gene.
atgttcattggtgccactttctgtgctccaaggggggcatcagcatccagggcatacgt
gccaactgcctggaaaaacttgcctgccacatcagagacctttcctgccacctcaagggt
ctttccatctacctctcatttccagcctgcctcttctaatgcctttagaggtccatctgc
cgcctcagagagcccaaagtcactgccatttgctctgcaggatccttatgcctgcgtaga
ggccctgcctgcagttccctgggttccgtatccagatggaaatgcctcatcagcatgtaa
gtcagtgcctgccatcttgatggtggcagcagctgccccccaggcaagtgccactgctgc
agaggcctctaagtcttcagagccgccaagacgccccggcaaagccaccaggaagaagaa
gcatctggaacccaaagaagacaactgtggccacaggctctcctcacgtgactggcgggg
gccccgaacctggggcaatcccagtcattctgactgggagattcagagggctatgcagct
cctgggggaccgggaatccctctacactccgcagggcctgaatgactgggggtgccccaa
cacttctaggatgccaaggagcttggagggccctagcacttcacgggaccaggaattctg
tggtgactcgggtgggtctcagacatggatggcttctgaggtcccaagcgtctctcgggg
atccagtgctgctcaggaggaccctgatagggagagtcagcccttatctcccttagatga
gagagcaaacgctttggtgcagtttctcttggtcaaagaccaagccaaggtgcctgtcca
gctctcggagatggtaaatgttgtcatccgagaatacaaagacgacagcttagacatcat
caaccgtgccaacactaagctggagtgcacctttggttgtcaactgaaggaagttgacac
caaaacccacacttacatcatcgtcaacaagatggcgtaccctcagtgtaatttgctggc
atcctatttagagaggccaaagttcagcctcctgatggtggtcttgagcctcatctttat
gaaaggctactgtatcagggagaatctgctctttagttttctgttccagctagggctgga
tgtccaggagacaagtggtctcttcagaattacaaagaagctcatcaccagtgtgtttgt
gagacacaggtacctagagtacaggcaaatcccgttcactgagcctgcagaatacgagct
tctctgggggccccgggcattcctcgaaaccaacagggtgcacatcttgagatttttggc
cgcactctacgagaaccagccccagatctggtcatgccagtaccttgactcactggcaga
gttagaatacaaggacgcaaatgccgccgccgaagagtcccatgacagcgatgatgatgc
ccacgaccccaccagcagtccccatcctcactaat

https://img-fotki.yandex.ru/get/1003446/158289418.4ee/0_1911ac_db9a337f_orig.png
В этом белке попался семидольный ритм, но структура не периодическая...

822

Re: Online service PROTEIN PICOTECHNOLOGY

Формы, механизмы, энергия наномира - 98 029

Putin's Ruby Emdrive / Рубиновый Сармат / Satan-Ruby

Human Genome Protein Structure

Online service PROTEIN PICOTECHNOLOGY

Предложение для Курчатовского института.

Проверка таблицы композиционного генетического кода

Skype, 2018-04-24:

[23.04.2018 17:55:57] Кушелев Александр Юрьевич: Привет! Когда едем в Курчатовский?
[23.04.2018 18:06:58] Менеджер D: я сказал, что ты позвонишь завтра и проговоришь какие последовательности нужны. Набери её скажи, что вы договаривались с Менеджером D вернуться к этому разговору через неделю, поэтому я звоню
[23.04.2018 20:00:23] Кушелев Александр Юрьевич: ОК
[9:57:16] Кушелев Александр Юрьевич: Только что звонил в Курчатовский. Она сказала, что сейчас находится в командировке. Приедет на следующей неделе и займётся кодами.
[10:09:35] Менеджер D: Вот же, а ты уточнил дату?
[10:11:57] Кушелев Александр Юрьевич: Следующая неделя начинается с Пн. Вот я и позвоню в Пн. Если рано, она уточнит дату smile
[10:12:06] Менеджер D: хорошо
[10:12:06] Кушелев Александр Юрьевич: Зачем человека перенапрягать?
[10:12:28] Кушелев Александр Юрьевич: Я так понял, что они там все замотанные какие-то
[10:12:55] Менеджер D: Так там же Путин был
[10:15:40] Кушелев Александр Юрьевич: А...
[10:17:29] Кушелев Александр Юрьевич: Надо будет их спросить, не спрашивал ли Владимир Владимирович, как продвигается проверка Пикотехнологии? Ведь в декабре 2017 года я им послал письмо, где темой письма было: "Копия письма президенту РФ".

А вот и копия этого письма от 14 декабря 2017 года, зарегистрированного под номером ПГ 463:

Формы, механизмы, энергия наномира. Сообщение 93 581

Предложение для Курчатовского института.

Уважаемый президент России, Владимир Владимирович!
В лаборатории Наномир создана высокая технология двойного назначения "Пикотехнология белков", которая может многократно увеличить бюджет России. Она создана на базе научного открытия. Открыт композиционный генетический код, по которому не только выбираются аминокислоты при сборке белков, но и задаются их углы поворотов. Эта технология работает примерно в миллиард раз  быстрее рентгеноструктурного анализа, за который заказчики ежедневно платят примерно миллион евро. Новая технология проверена тремя независимыми методами:
1. Корреляция с рентгеноструктурным анализом.
2. Замыкание дисульфидных мостиков, определенных химическими методами
3. Обнаружение сверхдлинных спиралей белковых молекул.
Окончательную проверку новой технологии может сделать Курчатовский институт, в котором есть специализированная лаборатория рентгеноструктурного анализа.
Предложение для Курчатовского ин-та: http://nanoworld.org.ru/topic/1872/
Примите к сведению!
С уважением,
Александр Кушелев,
Руководитель лаборатории Наномир.

823

Re: Online service PROTEIN PICOTECHNOLOGY

Формы, механизмы, энергия наномира. Сообщение 100 281

Online service PROTEIN PICOTECHNOLOGY

Совершенствуем программу Пикотех-2D (8-я версия)

Пробный заказ 2018-07-17:

Обсуждение с программистом...

Skype, 2018-07-17:

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/y46y6dh03ZFpKf

[8:29:48] Кушелев Александр Юрьевич: Одиночные коды "2" превращаются в коды "8". И соответственно столбец 8var

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/0pqI6DcY3ZFry4

[8:33:22] Кушелев Александр Юрьевич: А здесь одиночные коды "2", т.е. уже "8" должны стать бледными.
[8:33:58] Кушелев Александр Юрьевич: Сейчас покажу, какими конкретно...

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/Gp5cnvoP3ZFp3n

[8:43:28] Кушелев Александр Юрьевич: color=[100, 255, 100]
[10:19:11] Инвестор V: Вижу.
[10:31:52] Кушелев Александр Юрьевич: Ура!

824

Re: Online service PROTEIN PICOTECHNOLOGY

Формы, механизмы, энергия наномира. Сообщение 100 277

Ответ из института белка

Совершенствуем программу Пикотех-2D (8-я версия)

Online service PROTEIN PICOTECHNOLOGY

Кушелев: Добрый день!
На Ваш вопрос о цене структуры белка специалист дал неожиданный ответ: "Для нас бесплатно". Это понятно, т.к. они сами вырастили кристаллы белков, а просвечивание кристалла рентгеном - это как на кнопку фотоаппарата нажать. В Курчатовском институте (г.Москва) бесплатно просвечивают рентгеном готовые кристаллы белка.
А реальную цену в Вашей стране легко узнать следующим образом. Нужно его спросить:
"Можете вырастить кристаллы этих двух белков, и сколько это будет стоить? Вторичная структура этих белков, определенная программой Пикотех, представлена в первых двух столбцах:

https://img-fotki.yandex.ru/get/879536/158289418.4a9/0_186fc0_a6332fad_orig.png
Нас интересуют кристаллы двух белков:
XM_022674627.1 и KGO44433

825

Re: Online service PROTEIN PICOTECHNOLOGY

Формы, механизмы, энергия наномира. Сообщение 101 202

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-09-04-001:

Ищем белок по нотам мелодии "Петушок погромче пой"

Слушать песню (на латвийском): https://yadi.sk/d/JXOoo26P04Gdsw

Ноты: EGFEEGFE

Аминокислотная последовательность: tqkttqkt

Один из белков, содержащих такую последовательность:

https://www.ncbi.nlm.nih.gov/protein/OG … WPG4F2N01R

ATP-dependent DNA helicase [Geobacteraceae bacterium GWC2_53_11]

Геном, содержащий, вероятно, программную спираль, музыка сборки которой легла в основу мелодии "Петушок погромче пой": https://www.ncbi.nlm.nih.gov/nuccore/1085230279

CDS             complement(1370..2773)
                     /protein_id="OGU13475.1"
                     /translation="MTQFQETETLELKKSTSELKEAVISIVAMLNKHQRGEVLFGVRN
                     DGAVAGQQVSDKTLRDISKAIADHIEPKIYPVVEHVAFDSKQCVKVRVEGKEHPYYAY
                     GRAYIRVGDEDRQLSARELEKLILEKNRDRLRWDTEVCTKATVDDIGPGKLKSFLKLS
                     GLKFDTIPNTLEKLNLVRDGKLLNAAVLCFARKPEKFFPNARLRCAVFGTLDTTFTIS
                     MQDFYGDVFYLIKKAEEYILEHINIGMRLDGMLRVDVPEIDPEAFREAIINAFCHRDY
                     REYDSVNIAIFKDRVEIRSPGLLYGGLTIASIRKKMVSSRRNELLAELFQRSHRIEKW
                     GRGIKMILEREPATEFEEIGTVQFIATFKRKNVEAVFSDSVGEKVGEKVGETSEKTTQ
                     KTTQKTTQKTTQKTTQKTTQKILELIAGNPKISRVELAAAIGITADGIKYQLDKMRKE
                     GMLKRIGPDKGGYWEIV"

                                                                                         t caaacaatct
     1381 cccaataccc gcccttatcc ggcccgatac gctttaacat cccttctttc ctcatcttgt
     1441 ccaactgata tttgataccg tctgcagtaa ttccaattgc tgcggctagc tcgacacggc
     1501 tgattttggg atttccggca atcagttcca gaattttctg ggtagttttc tgggtagttt
     1561 tctgggtagt tttctgggta gttttctggg tagttttctg ggtagttttc tccgaagttt
     1621 caccgacctt ttcaccgacc ttttcaccga cactgtcgct gaaaacagcc tcaacattct
     1681 tccgcttaaa agtggcaata aactgaaccg tgccgatttc ctcaaactcc gtcgccggtt
     1741 cccgttccag aatcatcttg atgccacggc cccatttctc gatacgatgg ctgcgctgga
     1801 acaactccgc cagcaattca ttacgccggg aagaaaccat tttcttcctg atagacgcaa
     1861 tggtcagccc accgtagagc aggccgggac tgcggatttc cacccgatcc ttgaaaatgg
     1921 cgatattgac cgaatcgtat tcccggtaat cccgatggca aaatgcgttg atgatcgcct
     1981 cacgaaacgc ctccgggtca atttcgggca catccacccg cagcatcccg tccaggcgca
     2041 taccgatgtt gatatgttcg agaatgtatt cctcggcttt tttgatcaga taaaagacat
     2101 cgccatagaa atcctgcata ctgatggtaa atgtggtatc caacgtcccg aacacggcgc
     2161 aacgcagccg ggcgttagga aagaactttt ccggtttgcg ggcaaaacag agcacggcgg
     2221 cgttcagcag tttgccgtct ctgaccagat tcagtttttc gagggtgttg gggatggtgt
     2281 cgaacttgag accactaagt ttcagaaagg atttcagctt gccagggccg atgtcgtcaa
     2341 cggtcgcctt ggtgcatacc tcggtatccc agcggagccg gtcacggttt ttctccagaa
     2401 tcagcttttc cagttcgcgg gcacttaact gccggtcttc atcgccaacc cggatatatg
     2461 ctcggccata ggcatagtag gggtgctcct tgccttcgac ccgtaccttg acgcattgtt
     2521 tggaatcaaa cgcaacgtgt tcgacaacgg ggtagatttt gggttcgatg tggtcggcaa
     2581 ttgccttgga aatatcgcgg agggttttat cggaaacctg ctgaccggca acagcgccgt
     2641 cgtttctgac gccgaacagt acttcgcccc gctggtgctt gttcagcata gccacaatcg
     2701 agatcaccgc ctccttcagt tcggaggtgg atttcttcaa ctcaagggtt tccgtttctt
     2761 gaaattgggt cat

Нуклеотидная последовательность в стандарте fasta:

>OGU13475
atgacccaatttcaagaaacggaaacccttgagttgaagaaatccacctccgaactgaag
gaggcggtgatctcgattgtggctatgctgaacaagcaccagcggggcgaagtactgttc
ggcgtcagaaacgacggcgctgttgccggtcagcaggtttccgataaaaccctccgcgat
atttccaaggcaattgccgaccacatcgaacccaaaatctaccccgttgtcgaacacgtt
gcgtttgattccaaacaatgcgtcaaggtacgggtcgaaggcaaggagcacccctactat
gcctatggccgagcatatatccgggttggcgatgaagaccggcagttaagtgcccgcgaa
ctggaaaagctgattctggagaaaaaccgtgaccggctccgctgggataccgaggtatgc
accaaggcgaccgttgacgacatcggccctggcaagctgaaatcctttctgaaacttagt
ggtctcaagttcgacaccatccccaacaccctcgaaaaactgaatctggtcagagacggc
aaactgctgaacgccgccgtgctctgttttgcccgcaaaccggaaaagttctttcctaac
gcccggctgcgttgcgccgtgttcgggacgttggataccacatttaccatcagtatgcag
gatttctatggcgatgtcttttatctgatcaaaaaagccgaggaatacattctcgaacat
atcaacatcggtatgcgcctggacgggatgctgcgggtggatgtgcccgaaattgacccg
gaggcgtttcgtgaggcgatcatcaacgcattttgccatcgggattaccgggaatacgat
tcggtcaatatcgccattttcaaggatcgggtggaaatccgcagtcccggcctgctctac
ggtgggctgaccattgcgtctatcaggaagaaaatggtttcttcccggcgtaatgaattg
ctggcggagttgttccagcgcagccatcgtatcgagaaatggggccgtggcatcaagatg
attctggaacgggaaccggcgacggagtttgaggaaatcggcacggttcagtttattgcc
acttttaagcggaagaatgttgaggctgttttcagcgacagtgtcggtgaaaaggtcggt
gaaaaggtcggtgaaacttcggagaaaactacccagaaaactacccagaaaactacccag
aaaactacccagaaaactacccagaaaactacccagaaaattctggaactgattgccgga
aatcccaaaatcagccgtgtcgagctagccgcagcaattggaattactgcagacggtatc
aaatatcagttggacaagatgaggaaagaagggatgttaaagcgtatcgggccggataag
ggcgggtattgggagattgtttga

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/rh-1HkZfUMvu9Q

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/at18JXiy63WDLw
Вторичная структура полностью: https://yadi.sk/i/Jq0A-RV9xILnPg

Под циклический фрагмент музыки "Петушок погромче пой" строится 6.5 периодов программной 5577-спирали.

Обратите внимание на то, что первый аминокислотный остаток отличается по химическому составу, но не по высоте ноты!

826

Re: Online service PROTEIN PICOTECHNOLOGY

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-09-04-002:

Ещё один белок, содержащий фрагмент, который строится под циклическую мелодию из песни "Петушок погромче пой".

https://www.ncbi.nlm.nih.gov/protein/XP … WPG4F2N01R

https://www.ncbi.nlm.nih.gov/nuccore/942128036

PREDICTED: Latimeria chalumnae otogelin (OTOG), mRNA

Файл в стандарте fasta:

>XM_014485269
atgaggtacggattacctttaaagaacaaatctagccttgttctcttgtctcatagcaag
aacaacagtgaaatactcaagaaatgggatactgcttcccaaggaaaacagggattagaa
acaactataactactttttcatctattgaaacacctcctgtggtgagaaaccttccagct
ttagtagaacaatctcctgatacttgctcagtaccatgtcttaatggtggcgaatgtaca
tatttggaccagtgcaactgcagccaatttaatgcacaaggatcaaggtgccaaacagtt
cccaacactggatatgaaagagacatgatctgtcggacatggggacagtacaattttgaa
acatttgatggactttactttaactttcctggaacatgtatgtatacacttgtgaaagac
tgtgatcaatctgaacccaccttcttagtacaggcttttccaggtcctggcgatgtccat
ttcaaaatttgtgctttggcaatgccatcacaccttgcagtggtggatgatttattctat
attcaagcctttgaggggctttttacctactggcagatggttcacaatgatccacaatgt
catttttcttcatcttcctgtcaacgttctgttagtttattcttttcgtctgcggaagaa
ataaggttaaaaggatctcaagtcacttgtaatggaatgagcatcacactgccatatact
tcccgcaaaataagggtagaaagaatagcagagcatgtattggttacacaccatcatata
tttattctggcttgggatggcaactcaggagtctatataaagatgaatccagagtatatt
ggtaagacatgtgggctatgtggaaacttcactggggacctacaggatgacctcttaacc
agcagcggtcttttaacagaagatattgcaacgtttgctaacagctggatggaaccatat
ccaaatgaatcttgtacatatgtaccaactaactatccatcaccttgctctacacaaagc
caagaaactctcaaggtaatatatactctatgtaatagactcctggaatcaccgttcata
aaatgccagtaccatgtgagcccctaccctttcctagcaagttgtacaaatgacctttgc
atgtctggtcctgaggatgtaattttgtgtcgagcactgaatgaatatgccagagcttgt
gcccaggcaggttatcctcttcatggctggagaagaaaaatccctcagtgtgcggtgggg
tgtgaaggagagcttatctatagggagtgtattagctgttgtccaagtttatgtcaccac
cacatgaaacagtgtttcgacagtgaactccagtgtcttgatgggtgttactgtcctgaa
gagttgatttatgagaatggaacctgcattaaaccctctgaatgcccatgtatgtttcat
gggatttcgtatgcaacaggctctgtggtacaagaagaatgcaacaactgcacttgtatg
ggaggaatatggaactgcacagacaacatttgtccagcggaatgctcagtaacaggggac
attcatttcatgacttttgatgggaagccatatacattccaggcaacgtgccagtacatt
ctggcaaagagtcgcagtagtggcaaatttactgttattcttcaaaacacagcttgtaga
gggaacttggatggctcctgcatccaatcagtgagtgttgttattgatcaagatcccaag
aagcaagtgacattgacacatacgggagaggtgtttgtctgtaatcagtacaaggtcaac
ctaccctacattgatggtttatttgaaattagacaactttcttcattgtttgtacaagta
aaaacaaagtttgggctgcaaatacaatatgacaaaggtgggcttcggctttaccttgta
gtggacggccaatggaaagatgacactgtggggctctgtggaaccttcaatgggaatatc
caagatgattttctatctcctgcaggagtgcctgaaagtattcctgaaatatttgccaac
tcctggaaaatttcatcagcttgtggttcaagcaagatcattccactgccagatccatgt
gatatacatcttcaggcagctccatatgcttcagaatcatgtagcgtcctcacaaaggat
atttttgctccatgtcaccaatacttgagcccaatttccttccatgagcagtgcaaatca
gatacctgtaaatgtggacagatatgtatgtgtgctgcacttgctcactatgctcgacag
tgcagaaaacatggagtaattatcgactttagaagaaatgttactgattgtgagctgagt
gcccttgtttctttatgggagaagtttactcacctggagctgcaggcattccaacttcag
gcctatggtactagttgcccaaatagtcaaacctattttaactgtagtgattcaatggaa
aatgatgagatgagcagaggaattgcttatgaaaagacctgtgagaatcagcttctcaac
atgaccttctctggagaagtcccctgcatttctgggtgtatttgtccaccaggttttatg
aaacatggtgatgagtgctttaaacctgacaactgtccctgcttctggaagggaaaggaa
tactttcctgaagacaaggtgacctctccctgctatacctgcatctgtcaacagggatca
tttcagtgcaccttccaaccctgtccgtcaacatgcacagcatacggagaccgtcattac
atgacttttgacggacttttgtttgatttcattggagcttgtaaagtttacttggttaag
agtaattcggatcctggtctatcggttattgctgaaaacatgaattgttataacactgga
attatttgcagaaagtttctacaaattaatgttggacgatcttttttagtatttgatgac
gacactggaattccaaacccatctagcttaatagacaaacagcaaaacgtacagatatgg
caagcaggattcttcaccattgttaattttcccaatgaaaatgttacaatcttgtgggat
cgaagaacaacagtgcatatccaagttggaccaaactggaagggtgagctattgggattg
tgtggaaattttgaccttaaaacaacaaatgaaatgcggactccagacaacattgagaca
gggaattcccaggagtttgggaatagctggtcagcagtagagtgtgtaaacagccctgat
atccagaatccatgcaacctgagtccattaagggaaccatatgccaagaaaaagtgtggg
atcttactgagtgaagtgtttgaagcctgccacccggtggttgatgttacctggtttcat
tcaaattgcctaacagacacatgtggctgtacccgtgggggtgattgtgagtgtttatgt
accagtgtgtcagcatacgcacaccgctgttgtcagcatgggattactgttgactggaga
tcccctactacttgcccttttgactgtgaatacttcaacaaatttctaggaaagggccct
tataaactggctgcttacttggatggtaaagcttttatggcagccaatctatctggtggt
attgttttcccagtaaagggagatgtctccattccaggaataagttttatgttgactcca
ggactgtataaacctaaagcatacgatactagcttgatttcctttgaagcagcagaaaga
cccaatttctttctacttttgggatccaatggttccctgttcctttcaaagtgggaagag
aatgaagagtttcaaacttcatctacatttatcttacacaaggatacctggattacagga
tacagttcttttgaatcatttaagaagcctggattcttcattcactacatgatatcctct
gtccatctgatgaaacatgaacacactgaaggatttcgacaatcttctcactttaggctc
attgaatctaattttagagctccagcacgctccacctgtgagtggagatatgacagctgt
gcaaccccatgtttcaagacctgccgagatcccacaggagaaaactgtgaaaccttacca
aaaatagaaggatgttttcctaaatgtccttcctacatggtactggacgaggttactatg
agatgcgtgtattttgaggactgcattaagccagcagttgttgttctaccttcacctcta
agtattacaacaataccacctgagcctgcctggaatctctctgttccagtactgtcaagt
acacactttgtttcagctactacaattccaagttcagccagtacatttaccacagttcta
aagctgaatactacaacacctcatgaagtttcaactgtatctatatcagaaaaaacactg
gcaacatctccagtaaaagttacagcctattcagtcaatatcacagctgctattcttcca
actacatcaccatatttgtctaaaactaccccttctataacagagtcaatgttgtcacca
tcagtagcaacaactgctcctaaagaaccagatacaactgctaaaacatctgcaaaggct
acttctagagaatttattaaaacaagtataccatacaaaactggaattacagaagtgagt
agtactgtgccatctcttgttaccacatctgtaactgacctatcacaagtaacttcaagc
aaaatggccataactgctgctgcaaccacagtgctgttcaagagagttacatcatcagca
attcctgaaacaataactacaccagagactggatcaaggatatttcccacaaaggaagtg
ccattaacaacacaaaaaactacacaaaaaccatatgtaattacagcatcaaattataca
gtacctacatcagtgcaagaaaaaaacctttctgctacaacatatccatcaaccacacat
atccctctccagtctactcagttaacatcaagtgtggtatatcccattttgacagaaatg
acttcatcatctttgacaatgtcacaagagcaaactaagtcattagaaacatcaactact
aaatatttatcaccaattgcaaatgcaacagagattacacttacgccttttacatggaaa
tcaacacctttaaatgttactgtatactcttcagttatgacaacccaaccatccactgct
tcctcatacccaacaacaaagcttaagacaacactaacacccataataacatcggaatca
acagttagaacagaatcagtaacagaaaaaacagagtactcaatgaaaaccgtaaaaaca
agcccagctgaaacattttcaacagaatttgtaaaaacaatttcagcttctaaagagtat
ccaagaactgtaccatatccaacaccagaacaaacaatttcattaaaaataacacccata
ggtgacactacctcaacagaaacacagtcagcgaccacaagatctcattatacaatggaa
aaacttttggaaacttcagcagtctctctcaaaacattaccaggtgcttggagtactaaa
gaaacctcaactgttttctatcctgagacgtcatcaattaaaaaaactttaaccaccaca
gcataccaaaccttaccagagacatcatcaatcactgttacatacccagtagctaaattc
agtacaataaggtctacagcaaaactgaccaccacatatccactatctgttggttcaact
actctttcagtctataatgttacattcagcactagatctcctacagaaattacagcagtg
tcatttacatcagctacaacagagacactgacttcttatccgcatacttctaaagaacat
actacagttttactttccacaggccagacaaggtttaaagaaacttcaccaccaaccatc
acccccttacttatatcacctatcacaaaaactacaactccaaaaacatcaaccgtaatt
tcattatcaccagagttaaatgtgactgcaggtgtgacatcaaatgagactgcagctaca
cagacatcagtagcaaaagccactataagttcaactacatctgctgtttcattatcacct
gcaatagctacatacacaaccctaagcaaagctacaagtgaaaaagtctcaactccatct
gcttctcttttaacatcagcctacagttcaactagctattctccagctataactagcagt
gtttctttcactacttcaagcccaatagtcaccacagaaaagctctctacaacaacaaaa
acctttactagcactgtgctttcaacaactgcaaccagccatgtcgaagcacatgttcct
gagactacaaaagaattaccattttcagagttttcaactgtgacactcgctccttcagtg
ccaagctcattacttcctactaagtactggactacagtgcccaaagaaacctctcgaaat
atgactgtacctaccacaaagaatctaacatctataagtattactcaacctgttcaggtt
tcaacatcaactgaagttacacttgaagctatgacaggtgcaacatttatgtcaactagt
tcctacataaaaaatgtgacctctcaatcaacccaaacttgcacagttccatttcctgaa
tatcctgatccttgcattgaatatttctgtgtgaatggccacttgattaaacacaataaa
actcaaacctgtccctataatgcaactgcacctacttgtggactaatgggacttgcactg
gaggttaatggagataagtgttgtccaaaatgggaatgcccatgtcaatgcaccatttat
agtgatctaagattgatgacctttgatggaagcaacttgggtatctttaaagcagcttca
tatattattactcacgtacagcaggaaatcataaccatcaaaacacaaaactgccagaac
ttaatgggggactacaggaactcaatcaagctatgcctggcaaccctcaacataacccat
ccaactcttctttttagcatcgatcgcctgaaaagaaaactatttgtgaattcaacatct
gtcagctctaaatacagaaaaaatggatttatgattatggatactggtcatatgtatttg
atcaaaacaccagctggaataaagataaaatggtttcacaacaccggaatgatgacaata
gagaccaatacctccagtaaattaacaaccatgggattgtgtggttactgtgatagaaac
caaacaaatgactttacactactgaatggtacagttcttagtgaaggggagaacccaaca
accttcatggacagctggcaagtgccaaatactttacgttatgtgggagaggatcggcgg
cgtgacgttaactgttcaaccagtgactgctctgagtgtttcagcatgctttataaccaa
accttcagcagctgccatccctttgtttctcctgaggtgttttgtgaaatctggatacaa
gatgaagaatatgtgaaaaatccttgtatagcactggctgcatatgtagcaacttgtcaa
aagtttaatatctgcataaaatggaggacttcagactactgctccttccattgccctcaa
gatttaaggtatcaagcttgtttgccagtgtgcaatgcaaaaacctgccagaactatgat
ttagagcatctggatgttcaagaatgctcaggactaagtgaaggctgtgtctgtccagaa
gggactgttcttcatcgttcctattctgatctctgtatcccagaggaaaagtgtgcctgc
actgacagtttcggaaccccacgagctccaggggagacatggaccacgtcaccagatagc
tgttgtacatacacgtgcataggcaatgataccattattccagtggaacataactgctct
gatgttatagaaccagaatgcaggcatggtgaagaagtggtaataatcctgtctgatgac
aaaagctgctgtcctcaaaaaacatgtatttgcaaccagacaatttgtgaaagttatatt
cctcagtgtagcgatgaagaaaaacttattcttaactataaggcagactcttgctgtcca
gaatatatttgtgtgtgtgctgcttgctctgacaatattccaaaatgtcaagatggagaa
attcttattgtggatggtaataccacagatagatgctgtcctggataccagtgcgtttgt
gaaacgcatcgctgtcctgagtacaactgttctttaggaaaagcaataatcgaagcatgg
agtccagagcaatgttgcccatataaaacatgtgtgtgtgcatgtgagacaattcctaaa
cccaattgcaaactgggagaagcaatacaaatagatgaagaattccaaaatgaccctgaa
aatcaatgtggttgcattaaatacaaatgtgtaaagaaccaggtgtgtgtagatgaagag
agaggtgtcttgcatccaggacagactattgtggaacatactcctaatggcttttgccat
attacccattgtactagccagactgatccacaaaccaactattaccagattagtgttaaa
agaataaactgtactgcaacgtgtcaatcaaaccaaaaatatgagcctcctgttgattta
acaacttgctgcggaatctgtaaaaatgtgacatgtctccacactatagaaaatggtaca
gttaaagcttatgagcctggcacctcttggatatcaaattgtgttagatatggatgcaca
gacacaatgttaggacctgttctaactgcatctccaattagctgtcctccctttaatgaa
actgaatgcctgaagatagggggaactattgtgcccttcatggatggatgctgtaagagc
tgtaaagaagatgcaaagttctgtcagaaagtgaccgtaaggatgaaaattcgaaagaat
gactgtaaaagtaatataccaattaacattgtttcatgtgatgggaaatgtccttctgcc
agtatttataattacaatattaacacatatgccaggttctgcaagtgctgcagggaaact
gggctgcaaacacgtactgtacagctattctgtagtggcaactcaacttgggtcagttat
tccatccaggagcccacagattgttcttgccagtggtcctag

Вторичная структура:

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/fVNdwa9JXKFmEg

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/GLPcON4dAZDC2g

Кушелев: Любопытная структура...

Здесь последовательность TTQKTTQK не образует периодической вторичной структуры.

827

Re: Online service PROTEIN PICOTECHNOLOGY

Формы, механизмы, энергия наномира. Сообщение 102 508

Victoriy пишет:

Чтобы иметь признание в научном мире, а соответственно и спрос (заказы белковых структур) необходимо методично и грамотно доносить информацию до всех желающих о пикотехнологии: я имею ввиду публиковаться в англоязычных широко цитируемых и индексируемых научных журналах.
Они сами начнут за Вами гоняться и просить опубликовать Вашу статью, нужно сделать хотя бы первый шаг.
Пример: мною были опубликованы тезисы в сборнике очередной Парнасовской конференции (FEBS3+ Meeting – XIth Parnas Conference – Young Scientists Forum “Biochemistry and Molecular Biology for Innovative Medicine”) этой осенью (http://www.biochemistry.org.ua/index.ph … e-medicine)

The UKRAINIAN BIOCHEMICAL JOURNAL, Volume 90, Special Issue, 2018, P. 147:

THE MOLECULAR CONSTRUCTOR PROGRAM BUILDS STRUCTURAL TEMPLATES OF PROTEINS ACCORDING TO THEIR DETERMINING NUCLEOTIDE SEQUENCES
V. V. Sokolik
SI Institute of Neurology, Psychiatry and Narcology,
National Academy of Medical Sciences of Ukraine, Kharkiv;
e-mail: Sokolik67@rambler.ru
The Molecular Constructor (MC) program was created to construct an individual structural template
for any protein with an undefined experimental structure and no homology on the basis of information
contained in the determining its nucleotide sequence of mRNA. Until now, the idea of coding the
information about the spatial structure of proteins in the genome has not been sufficiently substantiated.
This is due to the categorical nature of the known postulate that only the amino acid sequences
of proteins are encoded in the genome. At the same time from the concept of the primary structure
of the protein in the form of the amino acid sequence, the characteristic of the peptide bonds between
the amino acid residues involuntarily eludes. This means that they are identical, but it is not so. A
hypothesis was proposed that the information of the third nucleotide of codons should be re-coded
into the corresponding rotamer of the peptide bond directly by the most three-dimensional structure
of isoacceptor tRNAs. The concept of rotamers of the peptide bond as the main element of the protein
structural template formed during matrix synthesis at ω = 120° (R-rotamer), -120° (L-rotamer) and 0°
(0-rotamer) is introduced.
The conformers of the periodic secondary structure (right or left helix, β-sheet) in the protein are
encoded by repeating the corresponding codons at the same nucleotides at their third position, which
leads to the decoding of the patterns of rotamers of the peptide bounds: Rn, Ln or 0n. For example: the
sequence (GCC/G)n encodes the right spiral of polyalanine (Rn is the prototype of all α- and 3/10-helix),
whereas (GCA)n – the left helix (Ln represented in turns), and (GCТ)n – β-strand (0n).
Geometrical algorithm of the MS-program includes such components:
- library of atoms and amino acid residues in a Cartesian coordinate system;
- rotamers of peptide bond;
- table of the genetic code of the protein structural pattern;
- conditions for coding conformers of the secondary structure.
For structural template of protein, the MC-program calculates the coordinates of each atom, taking
into account the covalent radii of the latter, the lengths and multiplicities of the bonds, and the angles
between them. As a result, based on the decoded information of the file with the nucleotide sequence
of mRNA (input file .dne), the MC produces an output file .pdb with the coordinates of all the atoms
of the realized protein template and visualizes its 3D-structure.
http://ukrbiochemjournal.org/wp-content … 2018_s.pdf

После этого пришло приглашение опубликовать полновесную статью на эту тему в американском журнале Journal of Pharmacy and Pharmacology (ISSN 2328-2150):

Dear Sokolik V. V.,
This is Journal of Pharmacy and Pharmacology (ISSN 2328-2150), a professional journal published across the United States by David Publishing Company.
We have learned your paper entitled   " THE MOLECULAR CONSTRUCTOR PROGRAM BUILDS STRUCTURAL TEMPLATES OF PROTEINS ACCORDING TO THEIR DETERMINING NUCLEOTIDE SEQUENCES " 
from   THE FEBS3+ MEETING - XI PARNAS CONFERENCE ‘BIOCHEMISTRY AND MOLECULAR BIOLOGY FOR INNOVATIVE MEDICINE’, UKRAINE, 2018 .

Have you published complete version of this article? We are very interested in your paper and would like to publish your unpublished paper in our journal.
If you have the idea of making our journal a vehicle for your research interests, please send the electronic version in English of your papers or books to us in MS word format via email attachment.
It would be most grateful if you could provide us with a high quality paper in your area which might be published by our Journal of Pharmacy and Pharmacology, USA.
Hope you can consider our journal as a possibility and we look forward to seeing you at our JPP in the future.
Expect to get your reply soon.
Editorial Office
Journal of Pharmacy and Pharmacology
www.davidpublisher.org/Home/Journal/JPP

Я спросила сколько стоит публикация (в американских журналах это ООООчень дорого). Сейчас жду ответ.

Здравствуйте, уважаемая Виктория!

Я надеюсь, что инвесторы понимают, что цена публикации статьи - пыль по сравнению с доходом от пикотехнологии smile

828

Re: Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-10-27-001

Формы, механизмы, энергия наномира. Сообщение 102 625

Проигрыш из Апачей: GCCCGCCCGCCCGCCCH ->

QIIIQIIIQIIIQIII(NLD)
EIIIEIIIEIIIEIII(NLD)
FIIIFIIIFIIIFIII(NLD)

Первую последовательность система BLAST искать отказывается.

А по второй первый же белок с отметкой 100% идентичности попался очень интересный: https://www.ncbi.nlm.nih.gov/protein/PX … 9CU6MYC015

Это - вся его аминокислотная последовательность:

         1 mnvvkleaae tgtgtgivte ivieivieiv ieivieivie ivieivieiv ieiateivsd
       61 vnvvklevvm imieiaigiv ieidsyvdve kennkqrlsi ewltiscvev

Интересно будет посмотреть на его структуру...

https://www.ncbi.nlm.nih.gov/nuccore/1397884055

CDS             complement(153885..154217)
                     /locus_tag="DFR56_112153"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="PXW85175.1"
                     /translation="MNVVKLEAAETGTGTGIVTEIVIEIVIEIVIEIVIEIVIEIVIE
                     IVIEIVIEIATEIVSDVNVVKLEVVMIMIEIAIGIVIEIDSYVDVEKENNKQRLSIEW
                     LTISCVEV"

                                                                               ttagac ttcaacacag
   153901 cttattgtta gccactcgat cgagaggcgt tgtttattat tctctttctc tacatctaca
   153961 tatgaatcga tctctatcac gatccctatc gcgatctcta tcatgatcat gacgacctct
   154021 aacttcacga cattcacatc tgaaacgatc tctgtcgcga tctctatcac gatctctatc
   154081 acgatctcta tcacgatctc tatcacgatc tctatcacga tctctatcac gatctctatc
   154141 acgatctcta tcacgatctc tgtcacgatc ccagtcccag tccctgtctc tgccgcctct
   154201 aacttcacga cattcac

В формате fasta:

gtgaatgtcgtgaagttagaggcggcagagacagggactgggactgggatcgtgacagag
atcgtgatagagatcgtgatagagatcgtgatagagatcgtgatagagatcgtgatagag
atcgtgatagagatcgtgatagagatcgtgatagagatcgcgacagagatcgtttcagat
gtgaatgtcgtgaagttagaggtcgtcatgatcatgatagagatcgcgatagggatcgtg
atagagatcgattcatatgtagatgtagagaaagagaataataaacaacgcctctcgatc
gagtggctaacaataagctgtgttgaagtctaa

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/9vPb8b86lNO7Lw

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/aAHoKp5PO24Yqg

Программная 2444-спираль, которая строится под очень симпатичную мелодию:

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/NoTwhFo7IOjQig
Слушать (MIDI): https://yadi.sk/d/fbk0HhWmZQ0ySg

829

Re: Online service PROTEIN PICOTECHNOLOGY

Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-10-27-002

Поиск по последовательности

дал: https://www.ncbi.nlm.nih.gov/protein/OT … 9F4C2D4015

  1 mgnnicnllr rrcslvqwiy yyreiiiiii iiiiiiiiii iiiiiiiiii iyeiivcedy
61 rs

Интересно, какую структуру образует полиизолейцин?

Следующий белок ещё круче: https://www.ncbi.nlm.nih.gov/protein/XP … 9F4C2D4015

        1 mpphpeeaer dghdeqrpll addttpvgqq qqqqqqqqpq qqqpppplgy srrrlllsgv
       61 lvlvaaiqga alvnpamnal vegaacqqlh pevkgpdryr drackaadvq drlamvmgwe
      121 stwalvpala taipygvfmd rrgpkvmatl vslggllvqv geltttlypn vfdlrgiwva
      181 sflgnlvggg plgfeatqya vasliatean rqvsipthgr hlllltlppl ldrtlvffyl
      241 aclvqlnfav sgplvywamn aspvvaqllg malmtlslll tftlpsgltt tkhvakaava
      301 pasvrqafak twraskqaat eflqlfrrda qlalllvslv fstigarqsl irqqyatnry
      361 gwtwaeagai islvslvsll vlavlvpaas awlltfktpl gkdlflarlg ilallvgsll
      421 vglsrttaqf vaaqavyamd acyppavtsv vasvaaaggg grtglvyvtv vfmrmvgslv
      481 agplvfgvfr vglrlggdwi glpfffeaal qvftvavtfw vrerrvgset vsdgegavgv
      541 aeygrpdqgk clsafraykt kynqvkrcpn gfrsefslei iiiiiiiiii iiiiiiiiii
      601 iiiiiiiiii iiiiiiiiii iiiiiiiiii iiiiiiiiii iiiiiiiiii iiiiiiiiii
      661 iiiiiiiiii iiiiiiiiii iiiiiiiiii iiiiiiiiii iiiiiiiiii iiiiiiiiii
      721 iiiiiiiiii iiiiiiiiii iiiiiiiiii iiiiitivik qqqrlsliit iinstpalyd
      781 lssttpmylt ktleiaalaf lgvr

https://www.ncbi.nlm.nih.gov/nuccore/1089735529

>XM_018847971.1 Isaria fumosorosea ARSEF 2679 Major facilitator superfamily domain, general substrate transporter (ISF_04365), partial mRNA
ATGCCCCCCCATCCTGAGGAAGCCGAACGCGACGGCCACGACGAGCAGCGACCCCTCCTGGCCGACGACA
CCACCCCCGTTGGTCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCCGCAGCAGCAGCAGCCACCTCCTCC
CCTCGGGTACTCACGGCGGCGCCTGTTGCTGTCCGGCGTGCTCGTCCTCGTCGCCGCGATCCAAGGCGCC
GCGCTGGTGAACCCGGCGATGAACGCGCTCGTCGAGGGCGCCGCCTGCCAGCAGCTGCACCCGGAGGTCA
AGGGCCCGGACCGGTACCGCGACCGGGCGTGCAAGGCGGCGGACGTGCAGGACCGGCTGGCCATGGTGAT
GGGCTGGGAGTCGACGTGGGCGCTGGTGCCGGCGCTGGCGACGGCGATCCCCTACGGGGTGTTCATGGAC
AGGCGCGGGCCAAAGGTGATGGCGACGCTGGTGTCGCTGGGGGGGTTGCTGGTCCAGGTGGGGGAGTTGA
CGACCACTCTTTATCCAAACGTGTTCGACTTGCGTGGGATCTGGGTCGCCTCGTTCCTGGGCAACCTTGT
CGGCGGCGGGCCGCTGGGCTTCGAGGCGACGCAGTATGCCGTCGCCAGCCTCATCGCCACCGAAGCCAAC
CGGCAAGTCTCCATACCGACCCACGGCCGGCATCTTCTCTTACTAACACTCCCTCCACTGCTTGATAGGA
CGCTCGTCTTCTTCTACTTGGCCTGCCTGGTCCAGCTCAACTTTGCCGTCAGCGGGCCCCTCGTCTACTG
GGCCATGAACGCCAGCCCCGTGGTCGCCCAGCTCCTCGGAATGGCCCTGATGACCCTGTCCCTGCTCCTG
ACGTTCACTCTGCCGAGCGGCCTGACGACGACCAAGCACGTGGCGAAGGCTGCCGTCGCGCCGGCATCTG
TCCGCCAGGCCTTTGCAAAGACGTGGAGGGCCAGCAAGCAGGCGGCCACCGAGTTCCTGCAGCTCTTTCG
TCGAGACGCGCAGCTGGCCCTGCTGCTCGTCAGCCTCGTCTTCAGCACCATCGGCGCACGGCAGTCCCTG
ATCCGGCAGCAGTACGCCACCAACCGGTACGGCTGGACCTGGGCCGAGGCCGGCGCCATCATCTCCCTCG
TCTCCCTCGTCAGCCTGCTCGTCCTCGCCGTGCTCGTGCCCGCCGCCAGCGCCTGGCTGCTCACCTTCAA
GACGCCCCTCGGCAAGGACCTGTTTCTCGCGCGCTTGGGCATCCTCGCGCTGCTCGTCGGCAGCCTCCTT
GTGGGCCTGTCGCGGACCACGGCGCAATTTGTCGCCGCGCAGGCCGTGTACGCCATGGACGCGTGCTACC
CGCCGGCCGTGACGAGCGTCGTCGCCTCCGTGGCCGCCGCCGGCGGGGGTGGACGGACGGGACTGGTGTA
CGTGACGGTGGTGTTCATGCGCATGGTCGGGTCGCTGGTGGCAGGGCCGCTGGTGTTTGGCGTGTTTCGC
GTGGGGTTGCGGCTCGGAGGTGATTGGATCGGGCTTCCGTTCTTCTTTGAGGCGGCGCTGCAGGTGTTTA
CCGTGGCGGTGACGTTTTGGGTCCGGGAGCGGCGCGTCGGGTCCGAGACGGTGTCGGACGGGGAGGGGGC
TGTAGGTGTGGCAGAGTACGGTAGACCAGACCAAGGCAAATGTCTCTCAGCGTTTCGTGCATACAAAACC
AAGTACAACCAAGTTAAGCGCTGTCCTAATGGTTTTCGCTCTGAATTCTCATTGGAAATCATCATCATCA
TCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCAT
CATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATC
ATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCA
TCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCAT
CATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATC
ATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCA
TCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCAT
CATCATCATCATCATCATCATCATCACCATCGTCATCAAACAACAACAACGGCTCAGCCTCATCATCACC
ATCATCAACTCAACACCAGCACTGTACGACCTGTCATCAACCACCCCCATGTACTTGACAAAGACCCTCG
AAATCGCTGCTCTCGCCTTCCTCGGCGTTCGTTGA

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/52nWq7teyinzBQ

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/X-q3mo6RfM-VWg

830

Re: Online service PROTEIN PICOTECHNOLOGY

Заказ 2018-10-27-003

По той же последовательности нашелся ещё один очень интересный белок:

https://www.ncbi.nlm.nih.gov/protein/XP … 9F4C2D4015

        1 mipkqgsppt satvshslpq hctsvaadsh iyselgrscd kmaplsydlv rgtknveday
       61 algvstrhsg iilsqvglck spcklfqmvq kkslwnllpg fvnvaskslf arvgiallpl
      121 llllppplll ifiieiieii eiieiieiie iieiieiiei ieiieiievi eiieiieiie
      181 iieiieiiei ieiieiieii eiieiieiie iieiieiiei meiieiieii eiieiieiie
      241 iieiveiifg ivcaiqcrpn skhalqscqk fnrcyfwwcc

https://www.ncbi.nlm.nih.gov/nuccore/149238070

>XM_001524862.1 Lodderomyces elongisporus NRRL YB-4239 predicted protein (LELG_03943) partial mRNA
ATGATCCCAAAGCAGGGGAGCCCACCGACCTCTGCTACCGTTTCCCATAGCCTACCACAACATTGCACTA
GTGTAGCTGCCGACTCACACATTTATTCTGAACTTGGCAGATCCTGCGACAAAATGGCGCCTTTGTCGTA
TGATCTTGTACGGGGAACGAAAAATGTGGAGGATGCATATGCACTAGGGGTATCAACAAGGCACAGCGGG
ATCATATTATCACAGGTTGGGTTGTGTAAGTCACCGTGCAAGTTGTTTCAGATGGTGCAGAAGAAAAGCT
TGTGGAATCTGCTTCCGGGGTTTGTTAATGTTGCATCAAAATCATTGTTTGCTCGTGTTGGAATAGCTTT
ACTACCACTACTACTACTGCTACCACCACCACTACTATTAATATTCATCATAGAAATCATAGAAATCATA
GAAATCATAGAAATCATAGAAATCATAGAAATCATAGAAATCATAGAAATCATAGAAATCATAGAAATCA
TAGAAATCATAGAAGTCATAGAAATCATAGAAATCATAGAAATCATAGAAATCATAGAAATTATAGAAAT
TATAGAAATTATAGAAATTATAGAAATTATAGAAATTATAGAAATTATAGAAATTATAGAAATTATAGAA
ATTATAGAAATTATAGAAATTATAGAAATTATGGAAATTATAGAAATTATAGAAATTATAGAAATTATAG
AAATTATAGAAATCATAGAAATAATAGAAATCGTAGAAATCATATTTGGCATAGTGTGTGCTATCCAGTG
TCGACCAAACTCAAAGCATGCGCTTCAAAGTTGTCAAAAATTTAACCGGTGTTATTTCTGGTGGTGTTGC
TGA

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/B5htrfbF06hJow

https://getfile.dokpub.com/yandex/get/https://yadi.sk/i/TFaPBUf1fi9gJA

Аминокислотная последовательность IEI образует программную 275-спираль, переходящая в 277-спираль